Allele Report for DRB1*01:35

DRB1*01:35 View HGVS Report
Pre-2010 Nomenclature: Local Names: BY00767
IMGT/HLA Acc No: HLA06514 OMIM Entry: *142857
Assigned: 2011-01-31 Sequence Last Modified: 2011-04-08
Source Entries: HQ717426 , HQ850049  
Cells Sequence Derived From: BY00767 , HG00002657  
Known Ethnic Origin Of Source: Caucasoid
CWD v2.0 Status: Not defined
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
RFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDNYCRHNYGA
VESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGTGGCAGCTTAAGTTTGAATGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTGCTGGAAAGATGCATC
TATAACCAAGAGGAGTCCGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTGATGC
CGAGTACTGGAACAGCCAGAAGGACCTCCTGGAGCAGAGGCGGGCCGCGGTGGACAATTACTGCAGACACAACTACGGGG
CTGTGGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo