Allele Report for DRB1*01:33N

DRB1*01:33N View HGVS Report
Pre-2010 Nomenclature: Local Names: 20834
IMGT/HLA Acc No: HLA05853 OMIM Entry: *142857
Assigned: 2010-09-30 Sequence Last Modified: 2010-10-15
Source Entries: HM590628  
Cells Sequence Derived From: 20834  
Known Ethnic Origin Of Source: Unknown
CWD v2.0 Status: Not defined
Publications
Zimmerman A et al. Tissue Antigens 78:463-464 2011. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (45 aa)
RFLWQLNLNVISSMGRSGCGCWKDASITKRSPCASTATWGSTGRX
Nucleotide Sequence Data (269 bps)
CACGTTTCTTGTGGCAGCTTAATTTGAATGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTGCTGGAAAGATGCATCT
ATAACCAAGAGGAGTCCGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTGATGCC
GAGTACTGGAACAGCCAGAAGGACCTCCTGGAGCAGAGGCGGGCCGCGGTGGACACCTACTGCAGACACAACTACGGGGT
TGGTGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo