Allele Report for DRB1*01:23

DRB1*01:23 View HGVS Report
Pre-2010 Nomenclature: DRB1*0123 Local Names: BY00499
IMGT/HLA Acc No: HLA04037 OMIM Entry: *142857
Assigned: 2009-07-31 Sequence Last Modified: 2009-10-19
Source Entries: GQ410118 , GU017971 , GU320617  
Cells Sequence Derived From: BY00499 , BY00636 , HG00002239  
Known Ethnic Origin Of Source: Black
Publications
Lazaro AM et al. Tissue Antigens 78:195-202 2011. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 3 Laboratories: 2
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
RFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEDRRAAVDTYCRHNYGA
VESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGTGGCAGCTTAAGTTTGAATGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTGCTGGAAAGATGCATC
TATAACCAAGAGGAGTCCGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTGATGC
CGAGTACTGGAACAGCCAGAAGGACCTCCTGGAAGACAGGCGCGCCGCGGTGGACACCTATTGCAGACACAACTACGGGG
CTGTGGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo