Allele Report for DRB1*01:12

DRB1*01:12 View HGVS Report
Pre-2010 Nomenclature: DRB1*0112 Local Names: HLA-DRB1*01MVE0204
IMGT/HLA Acc No: HLA02056 OMIM Entry: *142857
Assigned: 2004-12-20 Sequence Last Modified: 2005-01-12
Source Entries: AJ870972  
Alignment of CDS Source Entries
DRB1*01:01:01
DRB1*01:12
Submission 1

Locus Reference
  Virtual entry for DRB1*01:12 
  Individual submission(s) 
Cells Sequence Derived From: MHH0401996  
Known Ethnic Origin Of Source: Unknown
CWD v2.0 Status: Not defined
ISO OID: 2.16.840.1.113883.13.252 (HL7 Registered Organisational OID)
2.16.840.1.113883.13.252.1.1.2056 (Allele OID)
Publications
Horn PA et al. Tissue Antigens 65:505-6 2005. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Expert Assigned Type: DR1 WHO Assigned Type: -
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) - -
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DR1
Comments:
Protein Sequence (89 aa)
RFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRLAAVDTYCRHNYGV
GESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGTGGCAGCTTAAGTTTGAATGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTGCTGGAAAGATGCATC
TATAACCAAGAGGAGTCCGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTGATGC
CGAGTACTGGAACAGCCAGAAGGACCTCCTGGAGCAGAGGCTGGCCGCGGTGGACACCTACTGCAGACACAACTACGGGG
TTGGTGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IPD-IMGT/HLA

Sponsors