Allele Report for DRB1*01:07

DRB1*01:07 View HGVS Report
Pre-2010 Nomenclature: DRB1*0107 Local Names: DRB1*new
IMGT/HLA Acc No: HLA01307 OMIM Entry: *142857
Assigned: 2000-08-17 Sequence Last Modified: 2001-04-09
Source Entries: AJ276206 , AJ303118  
Cells Sequence Derived From: IOL Gae , IOL Ire , ZAE  
Known Ethnic Origin Of Source: Unknown
Publications
Voorter CE et al. Tissue Antigens 61:398-402 2003. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 3 Laboratories: 2
HLA Dictionary Data
Expert Assigned Type: DR1 WHO Assigned Type: DR1
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) - -
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DR1
Comments:
Protein Sequence (89 aa)
RFLWELKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGV
GESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGTGGGAGCTTAAGTTTGAATGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTGCTGGAAAGATGCATC
TATAACCAAGAGGAGTCCGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTGATGC
CGAGTACTGGAACAGCCAGAAGGACCTCCTGGAGCAGAGGCGGGCCGCGGTGGACACCTACTGCAGACACAACTACGGGG
TTGGTGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo