Allele Report for DRB1*01:02:03

DRB1*01:02:03 View HGVS Report
Pre-2010 Nomenclature: DRB1*010203 Local Names: conte
IMGT/HLA Acc No: HLA01875 OMIM Entry: *142857
Assigned: 2004-03-19 Sequence Last Modified: 2004-04-05
Source Entries: AJ430382  
Cells Sequence Derived From: 376P01  
Known Ethnic Origin Of Source: Caucasoid
CWD v2.0 Status: Not defined
Publications
Bontadini A et al. Tissue Antigens 64:624-6 2004. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Expert Assigned Type: DR1 WHO Assigned Type: DR1
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 2 DR1 [86-95%]
NMDP (2008) 2035 DR1 [95%]
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: Training - DR1
Comments:
Protein Sequence (89 aa)
RFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGA
VESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGTGGCAGCTTAAGTTTGAATGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTGCTGGAAAGATGCATC
TATAACCAGGAGGAGTCCGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTGATGC
CGAGTACTGGAACAGCCAGAAGGACCTCCTGGAGCAGAGGCGGGCCGCGGTGGACACCTATTGCAGACACAACTACGGGG
CTGTGGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo