Allele Report for DRB1*01:01:14

DRB1*01:01:14 View HGVS Report
Pre-2010 Nomenclature: DRB1*010114 Local Names: HistoGenetics HIS_NEW_DRB1_230_00018
IMGT/HLA Acc No: HLA04376 OMIM Entry: *142857
Assigned: 2009-09-30 Sequence Last Modified: 2009-10-19
Source Entries: FJ392247 , FN821964  
Cells Sequence Derived From: 20070821149 , HN-07537-5  
Known Ethnic Origin Of Source: Unknown
Publications
Van Sandt VST et al. Tissue Antigens 78:45-48 2011. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
RFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGV
GESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGTGGCAGCTTAAGTTTGAATGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTGCTGGAAAGATGTATC
TATAACCAAGAGGAGTCCGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTGATGC
CGAGTACTGGAACAGCCAGAAGGACCTCCTGGAGCAGAGGCGGGCCGCGGTGGACACCTACTGCAGACACAACTACGGGG
TTGGTGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo