Allele Report for DRB1*01:01:10

DRB1*01:01:10 View HGVS Report
Pre-2010 Nomenclature: DRB1*010110 Local Names: HLA-DRB1*01new allele
IMGT/HLA Acc No: HLA03912 OMIM Entry: *142857
Assigned: 2009-06-30 Sequence Last Modified: 2009-07-17
Source Entries: FJ392236 , FN395287  
Cells Sequence Derived From: 2718193 , HN-55044-1  
Known Ethnic Origin Of Source: Caucasoid
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
RFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGV
GESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGTGGCAGCTTAAGTTTGAATGTCATTTCTTCAATGGGACGGAGCGGGTACGGTTGCTGGAAAGATGCATC
TATAACCAAGAGGAGTCCGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTGATGC
CGAGTACTGGAACAGCCAGAAGGACCTCCTGGAGCAGAGGCGGGCCGCGGTGGACACCTACTGCAGACACAACTACGGGG
TTGGTGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo