Allele Report for DRB1*01:01:07

DRB1*01:01:07 View HGVS Report
Pre-2010 Nomenclature: DRB1*010107 Local Names: HLA-DRB1
IMGT/HLA Acc No: HLA03390 OMIM Entry: *142857
Assigned: 2008-06-30 Sequence Last Modified: 2008-10-10
Source Entries: AM992172 , FJ392234 , FJ392237 , FJ392239 , FJ392240 , FJ392241 , FJ392242 , FJ392243 , FJ392245 , FJ392246 , FJ392249 , FJ392252 , FJ392256 , FJ875601 , GU551919 , HM594812 , HM594813  
Alignment of CDS Source Entries
DRB1*01:01:01
DRB1*01:01:07
Submission 1
Submission 2
Submission 3
Submission 4

Locus Reference
  Virtual entry for DRB1*01:01:07 
  Individual submission(s) 

This feature is not currently available for some submissions of this allele.
Cells Sequence Derived From: 47995 , HG00002234 , HG00002235 , HG10011857 , HN-10439-8 , HN-13937-9 , HN-14364-3 , HN-14489-0 , HN-46163-3 , HN-61741-5 , HN-64829-7 , HN-70297-4 , HN-76700-4 , HN-81295-9 , HN-93534-0 , HN-96267-1 , HN-99986-3  
Known Ethnic Origin Of Source: Caucasoid
CWD v2.0 Status: Not defined
ISO OID: 2.16.840.1.113883.13.252 (HL7 Registered Organisational OID)
2.16.840.1.113883.13.252.1.1.3390 (Allele OID)
Publications
Hernandez-Frederick CJ et al. Tissue Antigens 84:497-502 2014. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 17 Laboratories: 2
HLA Dictionary Data
Expert Assigned Type: DR1 WHO Assigned Type: DR1
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 21 DR1 [95-100%]
NMDP (2008) 6317 DR1 [97%]
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: Training - DR1
Comments:
Protein Sequence (183 aa)
RFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGV
GESFTVQRRVEPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVP
RSGEVYTCQVEHPSVTSPLTVEW
Nucleotide Sequence Data (552 bps)
CACGTTTCTTGTGGCAGCTTAAGTTTGAATGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTGCTGGAAAGATGCATC
TATAACCAAGAGGAGTCCGTGCGCTTCGACAGCGACGTAGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTGATGC
CGAGTACTGGAACAGCCAGAAGGACCTCCTGGAGCAGAGGCGGGCCGCGGTGGACACCTACTGCAGACACAACTACGGGG
TTGGTGAGAGCTTCACAGTGCAGCGGCGAGTTGAGCCTAAGGTGACTGTGTATCCTTCAAAGACCCAGCCCCTGCAGCAC
CACAACCTCCTGGTCTGCTCTGTGAGTGGTTTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAACGGCCAGGAAGA
GAAGGCTGGGGTGGTGTCCACAGGCCTGATCCAGAATGGAGATTGGACCTTCCAGACCCTGGTGATGCTGGAAACAGTTC
CTCGGAGTGGAGAGGTTTACACCTGCCAAGTGGAGCACCCAAGTGTGACGAGCCCTCTCACAGTGGAATGGA
Genomic Sequence Data (0 bps)
Not Currently Available

IPD-IMGT/HLA

Sponsors