Allele Report for DRB1*01:01:06

DRB1*01:01:06 View HGVS Report
Pre-2010 Nomenclature: DRB1*010106 Local Names: HLA-DRB1
IMGT/HLA Acc No: HLA03389 OMIM Entry: *142857
Assigned: 2008-06-30 Sequence Last Modified: 2008-10-10
Source Entries: AM992171 , FJ392231 , FJ392254 , FJ392260 , FJ875598  
Cells Sequence Derived From: 36573 , HN-31251-0 , HN-49780-2 , HN-84578-0 , HN-85493-3  
Known Ethnic Origin Of Source: Caucasoid
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 5 Laboratories: 2
HLA Dictionary Data
Expert Assigned Type: DR1 WHO Assigned Type: DR1
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 21 DR1 [95-100%]
NMDP (2008) 6317 DR1 [97%]
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: Training - DR1
Comments:
Protein Sequence (183 aa)
RFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGV
GESFTVQRRVEPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVP
RSGEVYTCQVEHPSVTSPLTVEW
Nucleotide Sequence Data (552 bps)
CACGTTTCTTGTGGCAGCTTAAGTTTGAATGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTGCTGGAAAGATGCATC
TATAACCAAGAGGAGTCTGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTGATGC
CGAGTACTGGAACAGCCAGAAGGACCTCCTGGAGCAGAGGCGGGCCGCGGTGGACACCTACTGCAGACACAACTACGGGG
TTGGTGAGAGCTTCACAGTGCAGCGGCGAGTTGAGCCTAAGGTGACTGTGTATCCTTCAAAGACCCAGCCCCTGCAGCAC
CACAACCTCCTGGTCTGCTCTGTGAGTGGTTTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAACGGCCAGGAAGA
GAAGGCTGGGGTGGTGTCCACAGGCCTGATCCAGAATGGAGATTGGACCTTCCAGACCCTGGTGATGCTGGAAACAGTTC
CTCGGAGTGGAGAGGTTTACACCTGCCAAGTGGAGCACCCAAGTGTGACGAGCCCTCTCACAGTGGAATGGA
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo