Allele Report for DRB1*01:01:04

DRB1*01:01:04 View HGVS Report
Pre-2010 Nomenclature: DRB1*010104 Local Names: DRB1*010101TM
IMGT/HLA Acc No: HLA03225 OMIM Entry: *142857
Assigned: 2008-01-30 Sequence Last Modified: 2008-04-08
Source Entries: AM931296  
Cells Sequence Derived From: OT11400  
Known Ethnic Origin Of Source: Caucasoid
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Expert Assigned Type: DR1 WHO Assigned Type: DR1
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 21 DR1 [95-100%]
NMDP (2008) 6317 DR1 [97%]
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: Training - DR1
Comments:
Protein Sequence (89 aa)
RFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGV
GESFTVQRR
Nucleotide Sequence Data (270 bps)
CACGTTTCTTGTGGCAGCTTAAGTTTGAATGTCATTTCTTCAATGGGACGGAGCGGGTGCGGTTGCTGGAAAGATGCATC
TATAATCAAGAGGAGTCCGTGCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGCGGCCTGATGC
CGAGTACTGGAACAGCCAGAAGGACCTCCTGGAGCAGAGGCGGGCCGCGGTGGACACCTACTGCAGACACAACTACGGGG
TTGGTGAGAGCTTCACAGTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo