Allele Report for DQB1*06:93

DQB1*06:93 View HGVS Report
Pre-2010 Nomenclature: Local Names: HIS_NEW_DQB1_110460_00281
IMGT/HLA Acc No: HLA09737 OMIM Entry: *604305
Assigned: 2013-06-26 Sequence Last Modified: 2013-07-12
Source Entries: KC592347 , KF291285  
Cells Sequence Derived From: HG00005879 , HG00007629  
Known Ethnic Origin Of Source: Unknown
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
DFVYQFKGMCYFTNGTERVRLVTRHIYNREEYARFDSDVGVYRAVTPQGLPVAEYWNSQKEVLERTRAELDTVCRHNYEV
GYRGILQRR
Nucleotide Sequence Data (270 bps)
AGGATTTCGTGTACCAGTTTAAGGGCATGTGCTACTTCACCAACGGGACGGAGCGCGTGCGTCTTGTAACCAGACACATC
TATAACCGAGAGGAGTACGCGCGCTTCGACAGCGACGTGGGGGTGTACCGGGCGGTGACGCCGCAGGGGCTGCCTGTTGC
CGAGTACTGGAACAGCCAGAAGGAAGTCCTGGAGAGGACCCGGGCGGAGTTGGACACGGTGTGCAGACACAACTACGAGG
TGGGGTACCGCGGGATCCTGCAGAGGAGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo