Allele Report for DQB1*06:45

DQB1*06:45 View HGVS Report
Pre-2010 Nomenclature: Local Names: SZ100744
IMGT/HLA Acc No: HLA06876 OMIM Entry: *604305
Assigned: 2011-05-31 Sequence Last Modified: 2012-04-12
Source Entries: HQ651235  
Cells Sequence Derived From: SZ100744  
Known Ethnic Origin Of Source: Oriental
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (88 aa)
DFVYQFKGLCYFTNGTERVRYVTRYIYNREEDVRFDSDVGVYRAVTPQGRPDAEYWNSQKDILERTRAELDTVCRHNYEV
AFRGILQR
Nucleotide Sequence Data (267 bps)
AGGATTTCGTGTACCAGTTTAAGGGCCTGTGCTACTTCACCAATGGGACGGAGCGCGTGCGTTATGTGACCAGATACATC
TATAACCGAGAGGAGGACGTGCGCTTCGACAGCGACGTGGGGGTGTATCGGGCGGTGACGCCGCAGGGGCGGCCTGACGC
CGAGTACTGGAACAGCCAGAAGGACATCCTGGAGAGGACCCGAGCGGAGTTGGACACGGTGTGCAGACACAACTACGAGG
TGGCGTTCCGCGGGATCTTGCAGAGGA
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo