Allele Report for DQB1*06:126

DQB1*06:126 View HGVS Report
Pre-2010 Nomenclature: Local Names: HIS_NEW_DQB1_110511_00387
IMGT/HLA Acc No: HLA10300 OMIM Entry: *604305
Assigned: 2013-10-31 Sequence Last Modified: 2014-01-17
Source Entries: KC959352 , KM198163  
Cells Sequence Derived From: HG00006127 , HG00009240  
Known Ethnic Origin Of Source: Unknown
CWD v2.0 Status: Not defined
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
DFVFQFKGMCYFTNGTECVRLVTRYIYNREEYARFDSDVGVYRAVTPQGRPDAEYWNSQKEVLEGTRAELDTVCRHNYEV
AFRGILQRR
Nucleotide Sequence Data (270 bps)
AGGATTTCGTGTTCCAGTTTAAGGGCATGTGCTACTTCACCAACGGGACGGAGTGCGTGCGTCTTGTGACCAGATACATC
TATAACCGAGAGGAGTACGCGCGCTTCGACAGCGACGTGGGGGTGTACCGCGCGGTGACGCCGCAGGGGCGGCCTGATGC
CGAGTACTGGAACAGCCAGAAGGAAGTCCTGGAGGGGACCCGGGCGGAGTTGGACACGGTGTGCAGACACAACTACGAGG
TGGCGTTCCGCGGGATCTTGCAGAGGAGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo