Allele Report for DQB1*06:120

DQB1*06:120 View HGVS Report
Pre-2010 Nomenclature: Local Names: HIS_NEW_DQB1_110511_00389
IMGT/HLA Acc No: HLA10273 OMIM Entry: *604305
Assigned: 2013-10-31 Sequence Last Modified: 2014-01-17
Source Entries: KC959339 , KF882448  
Cells Sequence Derived From: HG00006095 , HG00008120  
Known Ethnic Origin Of Source: Unknown
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
DFVIQFKAMCYFTNGTERVRYVTRYIYNREEDVRFDSDVGVYRAVTPQGRPDAEYWNSQKDILERTRAELDTVCRHNYEV
AFRGILQRR
Nucleotide Sequence Data (270 bps)
AGGATTTCGTGATCCAGTTTAAGGCCATGTGCTACTTCACCAATGGGACGGAGCGCGTGCGTTATGTGACCAGATACATC
TATAACCGAGAGGAGGACGTGCGCTTCGACAGCGACGTGGGGGTGTATCGGGCGGTGACGCCGCAGGGGCGGCCTGACGC
CGAGTACTGGAACAGCCAGAAGGACATCCTGGAGAGGACCCGAGCGGAGTTGGACACGGTGTGCAGACACAACTACGAGG
TGGCGTTCCGCGGGATCTTGCAGAGGAGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo