Allele Report for DQB1*06:37

DQB1*06:37 View HGVS Report
Pre-2010 Nomenclature: DQB1*0637 Local Names: DQB1*06var
IMGT/HLA Acc No: HLA04119 OMIM Entry: *604305
Assigned: 2009-08-31 Sequence Last Modified: 2009-10-19
Source Entries: GQ422610  
Cells Sequence Derived From: 09212635  
Known Ethnic Origin Of Source: Caucasoid
CWD v2.0 Status: Not defined
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
DFVFQFKGMCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRAVTPQGRPDAEYWKSQKEVLERTRAELDTVCRHNYEV
AFRGILQRR
Nucleotide Sequence Data (270 bps)
AGGATTTCGTGTTCCAGTTTAAGGGCATGTGCTACTTCACCAACGGGACGGAGCGCGTGCGTCTTGTGACCAGATACATC
TATAACCGAGAGGAGTACGCGCGCTTCGACAGCGACGTGGGGGTGTACCGCGCGGTGACGCCGCAGGGGCGGCCTGATGC
CGAGTACTGGAAGAGCCAGAAGGAAGTCCTGGAGAGGACCCGGGCGGAGTTGGACACGGTGTGCAGACACAACTACGAGG
TGGCGTTCCGCGGGATCTTGCAGAGGAGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo