Allele Report for DQB1*06:22:01

DQB1*06:22:01 View HGVS Report
Pre-2010 Nomenclature: DQB1*0622 Local Names: YC0402
IMGT/HLA Acc No: HLA01967 OMIM Entry: *604305
Assigned: 2004-07-31 Sequence Last Modified: 2004-10-08
Source Entries: AY672649  
Cells Sequence Derived From: YC0402  
Known Ethnic Origin Of Source: Unknown
Publications
Chang Y et al. Tissue Antigens 70:442-4 2007. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Expert Assigned Type: DQ6 WHO Assigned Type: -
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) - -
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DQ6
Comments:
Protein Sequence (89 aa)
DFVFQFKGMCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRAVTPQGRPVAEYWNSQKEVLERTRAELDTVCRHNYEV
GYRGILQRR
Nucleotide Sequence Data (270 bps)
AGGATTTCGTGTTCCAGTTTAAGGGCATGTGCTACTTCACCAACGGGACGGAGCGCGTGCGTCTTGTGACCAGATACATC
TATAACCGAGAGGAGTACGCGCGCTTCGACAGCGACGTGGGGGTGTACCGGGCGGTGACGCCGCAGGGGCGGCCTGTTGC
CGAGTACTGGAACAGCCAGAAGGAAGTCCTGGAGAGGACCCGGGCGGAGTTGGACACGGTGTGCAGACACAACTACGAGG
TGGGGTACCGCGGGATCCTGCAGAGGAGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo