Allele Report for DQB1*06:20

DQB1*06:20 View HGVS Report
Pre-2010 Nomenclature: DQB1*0620 Local Names: HLA-DQB1*CB846
IMGT/HLA Acc No: HLA01612 OMIM Entry: *604305
Assigned: 2002-06-27 Sequence Last Modified: 2002-07-15
Source Entries: AF384556 , AY124588  
Cells Sequence Derived From: CB846  
Known Ethnic Origin Of Source: Caucasoid
Publications
Hogbin JP et al. Tissue Antigens 64:515-7 2004. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Expert Assigned Type: DQ6 WHO Assigned Type: -
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) - -
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DQ6
Comments:
Protein Sequence (80 aa)
FQFKGLCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRAVTPQGRPDAEYWNSQKEVLEGTRAELDTVCRHNYEVAFR
Nucleotide Sequence Data (240 bps)
TTCCAGTTTAAGGGCCTGTGCTACTTCACCAACGGGACGGAGCGCGTGCGTCTTGTGACCAGATACATCTATAACCGAGA
GGAGTACGCGCGCTTCGACAGCGACGTGGGGGTGTACCGCGCGGTGACGCCGCAGGGGCGGCCTGATGCCGAGTACTGGA
ACAGCCAGAAGGAAGTCCTGGAGGGGACCCGGGCGGAGTTGGACACGGTGTGCAGACACAACTACGAGGTGGCGTTCCGC
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo