Allele Report for DQB1*06:18:01

DQB1*06:18:01 View HGVS Report
Pre-2010 Nomenclature: DQB1*0618 Local Names: DQB1*06nou
IMGT/HLA Acc No: HLA01446 OMIM Entry: *604305
Assigned: 2001-02-26 Sequence Last Modified: 2001-10-26
Source Entries: AY026349  
Cells Sequence Derived From: IM0000053  
Known Ethnic Origin Of Source: Unknown
CWD v2.0 Status: Not defined
Publications
Casamitjana N et al. Tissue Antigens 58:269-71 2001. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Expert Assigned Type: DQ6 WHO Assigned Type: -
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) - -
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DQ6
Comments:
Protein Sequence (85 aa)
YQFKGMCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRAVTPQGRPVAEYWNSQKEVLERTRAELDTVCRHNYEVAFR
GILQR
Nucleotide Sequence Data (259 bps)
TGTACCAGTTTAAGGGCATGTGCTACTTCACCAACGGGACGGAGCGCGTGCGTCTTGTAACCAGATACATCTATAACCGA
GAGGAGTACGCGCGCTTCGACAGCGACGTGGGGGTGTACCGGGCGGTGACGCCGCAGGGGCGGCCTGTTGCCGAGTACTG
GAACAGCCAGAAGGAAGTCCTGGAGAGGACCCGGGCGGAGTTGGACACGGTGTGCAGACACAACTACGAGGTGGCGTTCC
GCGGGATCTTGCAGAGGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo