Allele Report for DQB1*06:17

DQB1*06:17 View HGVS Report
Pre-2010 Nomenclature: DQB1*0617 Local Names: 99-3039
IMGT/HLA Acc No: HLA01175 OMIM Entry: *604305
Assigned: 1999-12-21 Sequence Last Modified: 2003-04-17
Source Entries: AF181983  
Cells Sequence Derived From: 15427-00/01/02  
Known Ethnic Origin Of Source: Unknown
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Expert Assigned Type: DQ6 WHO Assigned Type: -
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) 1
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DQ6
Comments:
Protein Sequence (89 aa)
DFVYQFKGMCYFTNGTERVRLVTRHIYNREEYARFDSDVGVYRAVTPQGRPVAEYWNSQKEVLEGARAELDTVCRHNYEV
GYRGILQRR
Nucleotide Sequence Data (270 bps)
AGGATTTCGTGTACCAGTTTAAGGGCATGTGCTACTTCACCAACGGGACGGAGCGCGTGCGTCTTGTAACCAGACACATC
TATAACCGAGAGGAGTACGCGCGCTTCGACAGCGACGTGGGGGTGTACCGGGCGGTGACGCCGCAGGGGCGGCCTGTTGC
CGAGTACTGGAACAGCCAGAAGGAAGTCCTGGAGGGGGCCCGGGCGGAGTTGGACACGGTGTGCAGACACAACTACGAGG
TGGGGTACCGCGGGATCCTGCAGAGGAGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo