Allele Report for DQB1*06:08:02

DQB1*06:08:02 View HGVS Report
Pre-2010 Nomenclature: DQB1*060802 Local Names: STFO3416AN
IMGT/HLA Acc No: HLA02609 OMIM Entry: *604305
Assigned: 2006-06-30 Sequence Last Modified: 2006-07-14
Source Entries: AM279416  
Cells Sequence Derived From: STFO3416AN  
Known Ethnic Origin Of Source: Caucasoid
CWD v2.0 Status: Not defined
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Expert Assigned Type: DQ6 WHO Assigned Type: DQ6(1)c
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) 6 DQ6 [50%] DQ1 [25%] DQ5 [25%]
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DQ6
Comments: DQ6  
Protein Sequence (89 aa)
DFVYQFKGMCYFTNGTERVRLVTRHIYNREEYARFDSDVGVYRAVTPQGRPVAEYWNSQKEVLEGTRAELDTVCRHNYEV
AFRGILQRR
Nucleotide Sequence Data (270 bps)
AGGATTTCGTGTACCAGTTTAAGGGCATGTGCTACTTCACCAACGGGACGGAGCGCGTGCGTCTTGTAACCAGACACATC
TATAACCGAGAGGAGTACGCGCGCTTCGACAGCGACGTGGGGGTGTACCGGGCGGTGACGCCGCAGGGGCGGCCTGTTGC
CGAGTACTGGAACAGCCAGAAGGAAGTCCTGGAGGGGACCCGGGCGGAGTTGGACACGGTGTGCAGACACAACTACGAGG
TGGCGTTCCGCGGGATCTTGCAGAGGAGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo