Allele Report for DQB1*06:05:01

DQB1*06:05:01 View HGVS Report
Pre-2010 Nomenclature: DQB1*060501 Local Names: DQB1*06051, DQBSLE, 2013-24, DQB 1.8
IMGT/HLA Acc No: HLA00649 OMIM Entry: *604305
Assigned: 1990-07-26 Sequence Last Modified: 2015-04-17
Source Entries: M36472 , M59800 , M65052 , U83585  
Cells Sequence Derived From: 2013 , C.I , KT , MR  
Known Ethnic Origin Of Source: Black, Oriental
CWD v2.0 Status: Well-Documented
Publications
Fronek Z et al. Hum Immunol 30:77-84 1991. (View abstract)
Lee KW et al. J Immunol 145:3119-25 1990. (View abstract)
Scharf SJ et al. Proc Natl Acad Sci U S A 86:6215-9 1989. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 4 Laboratories: 4
HLA Dictionary Data
Expert Assigned Type: DQ6 WHO Assigned Type: DQ6(1)
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) 358 DQ6 [76%] DQ1 [13%]
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DQ6
Comments:
Protein Sequence (250 aa)
SWKKALRIPGDLRVATVTLMLAMLSSLLAEGRDSPEDFVYQFKGLCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRA
VTPQGRPVAEYWNSQKEVLERTRAELDTVCRHNYEVGYRGILQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPGQIKV
QWFRNDQEETAGVVSTPLIRNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQSPITVEWRAQSESAQSKMLSGVGGFVLG
LIFLGLGLII
Nucleotide Sequence Data (751 bps)
GTCTTGGAAGAAGGCTTTGCGGATCCCCGGAGACCTTCGGGTAGCAACTGTCACCTTGATGCTGGCGATGCTGAGCTCCC
TACTGGCTGAGGGCAGAGACTCTCCCGAGGATTTCGTGTACCAGTTTAAGGGCCTGTGCTACTTCACCAACGGGACGGAG
CGCGTGCGTCTTGTAACCAGATACATCTATAACCGAGAGGAGTACGCGCGCTTCGACAGCGACGTGGGGGTGTACCGGGC
GGTGACGCCGCAGGGGCGGCCTGTTGCCGAGTACTGGAACAGCCAGAAGGAAGTCCTGGAGAGGACCCGGGCGGAGTTGG
ACACGGTGTGCAGACACAACTACGAGGTGGGGTACCGCGGGATCCTGCAGAGGAGAGTGGAGCCCACAGTGACCATCTCC
CCATCCAGGACAGAGGCCCTCAACCACCACAACCTGCTGGTCTGCTCGGTGACAGATTTCTATCCAGGCCAGATCAAAGT
CCAGTGGTTTCGGAATGATCAGGAGGAGACAGCCGGCGTTGTGTCCACCCCCCTTATTAGGAATGGTGACTGGACTTTCC
AGATCCTGGTGATGCTGGAAATGACTCCCCAGCGTGGAGATGTCTACACCTGCCACGTGGAGCACCCCAGCCTCCAGAGC
CCCATCACCGTGGAGTGGCGGGCTCAGTCTGAATCTGCCCAGAGCAAGATGCTGAGTGGCGTTGGAGGCTTCGTGCTGGG
GCTGATCTTCCTTGGGCTGGGCCTTATCATC
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo