Allele Report for DQB1*06:04:03

DQB1*06:04:03 View HGVS Report
Pre-2010 Nomenclature: DQB1*060403 Local Names: DQB1*060401variant
IMGT/HLA Acc No: HLA02602 OMIM Entry: *604305
Assigned: 2006-06-30 Sequence Last Modified: 2006-07-14
Source Entries: DQ503425  
Cells Sequence Derived From: WF215-200  
Known Ethnic Origin Of Source: Caucasoid
Publications
Nolan K et al. Tissue Antigens 68:456-7 2006. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Expert Assigned Type: DQ6 WHO Assigned Type: DQ6(1)
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 3 DQ1 [40-52%] DQ6 [40-44%] DQ5 [0-20%]
NMDP (2008) 1592 DQ6 [59%] DQ1 [27%] DQ5 [2%]
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DQ6
Comments:
Protein Sequence (89 aa)
DFVYQFKGMCYFTNGTERVRLVTRHIYNREEYARFDSDVGVYRAVTPQGRPVAEYWNSQKEVLERTRAELDTVCRHNYEV
GYRGILQRR
Nucleotide Sequence Data (270 bps)
AGGATTTCGTGTACCAGTTTAAGGGCATGTGCTACTTCACCAACGGGACGGAGCGCGTGCGTCTTGTAACCAGACACATC
TATAACCGAGAGGAGTACGCGCGCTTCGACAGCGACGTGGGGGTGTACCGGGCGGTGACGCCGCAGGGGCGGCCTGTTGC
CGAGTACTGGAACAGCCAGAAGGAAGTCCTGGAGAGGACCCGGGCGGAGTTGGACACCGTGTGCAGACACAACTACGAGG
TGGGGTACCGCGGGATCCTGCAGAGGAGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo