Allele Report for DQB1*06:04:01

DQB1*06:04:01 View HGVS Report
Pre-2010 Nomenclature: DQB1*060401 Local Names: DQB1*06041, DQw1.19, DQB 1.7 (DQB6), DQB 1.7
IMGT/HLA Acc No: HLA00648 OMIM Entry: *604305
Assigned: 1989-08-01 Sequence Last Modified: 1998-12-16
Source Entries: L34107 , M65051  
Cells Sequence Derived From: CMCC , DAUDI , DM23 , EMJ , LD , WG  
Known Ethnic Origin Of Source: Black, Caucasoid
CWD v2.0 Status: Common
Publications
Horn GT et al. Proc Natl Acad Sci U S A 85:6012-6 1988. (View abstract)
Todd JA et al. Nature 329:599-604 1987. (View abstract)
Horn GT et al. Hum Immunol 21:249-63 1988. (View abstract)
Turco E et al. Immunogenetics 26:282-90 1987. (View abstract)
Yasunaga S et al. Tissue Antigens 47:37-48 1996. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 6 Laboratories: 4
HLA Dictionary Data
Expert Assigned Type: DQ6 WHO Assigned Type: DQ6(1)
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 3 DQ1 [40-52%] DQ6 [40-44%] DQ5 [0-20%]
NMDP (2008) 1592 DQ6 [59%] DQ1 [27%] DQ5 [2%]
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DQ6
Comments:
Protein Sequence (229 aa)
RDSPEDFVYQFKGMCYFTNGTERVRLVTRHIYNREEYARFDSDVGVYRAVTPQGRPVAEYWNSQKEVLERTRAELDTVCR
HNYEVGYRGILQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPGQIKVQWFRNDQEETAGVVSTPLIRNGDWTFQILVM
LEMTPQRGDVYTCHVEHPSLQSPITVEWRAQSESAQSKMLSGVGGFVLGLIFLGLGLIIRQRSQKGLLH
Nucleotide Sequence Data (690 bps)
AGAGACTCTCCCGAGGATTTCGTGTACCAGTTTAAGGGCATGTGCTACTTCACCAACGGGACGGAGCGCGTGCGTCTTGT
AACCAGACACATCTATAACCGAGAGGAGTACGCGCGCTTCGACAGCGACGTGGGGGTGTACCGGGCGGTGACGCCGCAGG
GGCGGCCTGTTGCCGAGTACTGGAACAGCCAGAAGGAAGTCCTGGAGAGGACCCGGGCGGAGTTGGACACGGTGTGCAGA
CACAACTACGAGGTGGGGTACCGCGGGATCCTGCAGAGGAGAGTGGAGCCCACAGTGACCATCTCCCCATCCAGGACAGA
GGCCCTCAACCACCACAACCTGCTGGTCTGCTCGGTGACAGATTTCTATCCAGGCCAGATCAAAGTCCAGTGGTTTCGGA
ATGATCAGGAGGAGACAGCCGGCGTTGTGTCCACCCCCCTTATTAGGAATGGTGACTGGACTTTCCAGATCCTGGTGATG
CTGGAAATGACTCCCCAGCGTGGAGATGTCTACACCTGCCACGTGGAGCACCCCAGCCTCCAGAGCCCCATCACCGTGGA
GTGGCGGGCTCAGTCTGAATCTGCCCAGAGCAAGATGCTGAGTGGCGTTGGAGGCTTCGTGCTGGGGCTGATCTTCCTTG
GGCTGGGCCTTATCATCCGTCAAAGGAGTCAGAAAGGGCTTCTGCACTGA
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo