Allele Report for DQB1*06:02:02

DQB1*06:02:02 View HGVS Report
Pre-2010 Nomenclature: DQB1*060202 Local Names: HLA-DQB1*06 variant
IMGT/HLA Acc No: HLA03156 OMIM Entry: *604305
Assigned: 2007-11-30 Sequence Last Modified: 2008-01-11
Source Entries: AM900764  
Cells Sequence Derived From: 72330002  
Known Ethnic Origin Of Source: Caucasoid
CWD v2.0 Status: Not defined
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Expert Assigned Type: DQ6 WHO Assigned Type: DQ6(1)
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 22 DQ1 [38-73%] DQ6 [18-64%] DQ5 [0-12%]
NMDP (2008) 5151 DQ6 [67%] DQ1 [30%] DQ5 [1%]
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: Training - DQ1 DQ6
Comments:
Protein Sequence (89 aa)
DFVFQFKGMCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRAVTPQGRPDAEYWNSQKEVLEGTRAELDTVCRHNYEV
AFRGILQRR
Nucleotide Sequence Data (270 bps)
AGGATTTCGTGTTCCAGTTTAAGGGCATGTGCTACTTCACCAACGGGACGGAGCGCGTGCGTCTTGTGACCAGATACATC
TATAACCGAGAGGAGTACGCACGCTTCGACAGCGACGTGGGGGTGTACCGCGCGGTGACGCCGCAGGGGCGGCCTGATGC
CGAGTACTGGAACAGCCAGAAGGAAGTCCTGGAGGGGACCCGGGCGGAGTTGGACACGGTGTGCAGACACAACTACGAGG
TGGCGTTCCGCGGGATCTTGCAGAGGAGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo