Allele Report for DQB1*06:01:05

DQB1*06:01:05 View HGVS Report
Pre-2010 Nomenclature: DQB1*060105 Local Names: HLA DQB1*0601 variant
IMGT/HLA Acc No: HLA03991 OMIM Entry: *604305
Assigned: 2009-07-31 Sequence Last Modified: 2009-10-19
Source Entries: GQ355337  
Cells Sequence Derived From: C143843  
Known Ethnic Origin Of Source: Hispanic
CWD v2.0 Status: Not defined
Publications
Endres RO et al. Tissue Antigens 75:84-86 2010. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (183 aa)
DFVLQFKAMCYFTNGTERVRYVTRYIYNREEDVRFDSDVGVYRAVTPQGRPDAEYWNSQKDILERTRAELDTVCRHNYEV
AFRGILQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPGQIKVRWFRNDQEETAGVVSTPLIRNGDWTFQILVMLEMTP
QHGDVYTCHVEHPSLQSPITVEW
Nucleotide Sequence Data (552 bps)
AGGATTTCGTGCTCCAGTTTAAGGCCATGTGCTACTTCACCAATGGGACGGAGCGCGTGCGTTATGTGACCAGATACATC
TATAACCGAGAGGAGGACGTGCGCTTCGACAGCGACGTGGGGGTGTATCGGGCGGTGACGCCGCAGGGGCGGCCTGACGC
CGAGTACTGGAACAGCCAGAAGGACATCCTGGAGAGGACCCGAGCGGAGTTGGACACGGTGTGCAGACACAACTACGAGG
TGGCGTTCCGCGGGATCTTGCAGAGGAGAGTGGAGCCCACAGTGACCATCTCCCCATCCAGGACAGAGGCCCTCAACCAC
CACAACCTGCTGGTCTGCTCGGTGACAGATTTCTATCCAGGCCAGATCAAAGTCCGGTGGTTTCGGAATGACCAGGAGGA
GACAGCTGGCGTTGTGTCCACCCCCCTTATTAGGAATGGTGACTGGACCTTCCAGATCCTGGTGATGCTGGAAATGACTC
CCCAGCATGGAGACGTCTACACCTGCCACGTGGAGCACCCCAGCCTCCAGAGCCCCATCACCGTGGAGTGGC
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo