Allele Report for DQB1*06:01:04

DQB1*06:01:04 View HGVS Report
Pre-2010 Nomenclature: DQB1*060104 Local Names: BJ52
IMGT/HLA Acc No: HLA03307 OMIM Entry: *604305
Assigned: 2008-04-29 Sequence Last Modified: 2008-10-10
Source Entries: EU594579  
Cells Sequence Derived From: BJ52  
Known Ethnic Origin Of Source: Oriental
Publications
Zhang KY et al. Tissue Antigens 81:468-469 2013. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Expert Assigned Type: DQ6 WHO Assigned Type: DQ6(1)
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 6 DQ6 [50-56%] DQ1 [33-40%] DQ5 [10-11%]
NMDP (2008) 675 DQ6 [64%] DQ1 [23%]
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DQ6
Comments:
Protein Sequence (89 aa)
DFVLQFKAMCYFTNGTERVRYVTRYIYNREEDVRFDSDVGVYRAVTPQGRPDAEYWNSQKDILERTRAELDTVCRHNYEV
AFRGILQRR
Nucleotide Sequence Data (270 bps)
AGGATTTCGTGCTCCAGTTTAAGGCCATGTGCTACTTCACCAATGGCACGGAGCGCGTGCGTTATGTGACCAGATACATC
TATAACCGAGAGGAGGACGTGCGCTTCGACAGCGACGTGGGGGTGTATCGGGCGGTGACGCCGCAGGGGCGGCCTGACGC
CGAGTACTGGAACAGCCAGAAGGACATCCTGGAGAGGACCCGAGCGGAGTTGGACACGGTGTGCAGACACAACTACGAGG
TGGCGTTCCGCGGGATCTTGCAGAGGAGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo