Allele Report for DQB1*05:52

DQB1*05:52 View HGVS Report
Pre-2010 Nomenclature: Local Names: HIS_NEW_DQB1_110555_00457
IMGT/HLA Acc No: HLA10549 OMIM Entry: *604305
Assigned: 2013-11-29 Sequence Last Modified: 2014-01-17
Source Entries: KF220336 , KF291288 , KF381264 , KF415264 , KF882458  
Cells Sequence Derived From: HG00006323 , HG00008175 , HG00008176 , HG00008177 , HG00008178  
Known Ethnic Origin Of Source: Unknown
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 5 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
DFVYQFKGLCYFTNRTERVRGVTRYIYNREEYVRFDSDVGVYRAVTPQGRPSAEYWNSQKDILEEDRASVDRVCRHNYEV
AYRGILQRR
Nucleotide Sequence Data (270 bps)
AGGATTTCGTGTACCAGTTTAAGGGCCTGTGCTACTTCACCAACAGGACGGAGCGCGTGCGGGGTGTGACCAGATACATC
TATAACCGAGAAGAGTACGTGCGCTTCGACAGCGACGTGGGGGTGTACCGGGCGGTGACGCCGCAGGGGCGGCCTAGCGC
CGAGTACTGGAACAGCCAGAAGGACATCCTGGAGGAGGACCGGGCGTCGGTGGACAGGGTGTGCAGACACAACTACGAGG
TGGCGTACCGCGGGATCCTGCAGAGGAGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo