Allele Report for DQB1*05:28

DQB1*05:28 View HGVS Report
Pre-2010 Nomenclature: Local Names: HIS_NEW_DQB1_110473_00304
IMGT/HLA Acc No: HLA09743 OMIM Entry: *604305
Assigned: 2013-06-26 Sequence Last Modified: 2013-07-12
Source Entries: KC632191 , KF737204  
Cells Sequence Derived From: HG00005886 , HG00008180  
Known Ethnic Origin Of Source: Unknown
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
DFVYQFKGLCYFTNGTERVRGVTRHIYNREEYMRFDSDVGVYRAVTPQGRPDAEYWNSQKEVLEGARASVDRVCRHNYEV
AYRGILQRR
Nucleotide Sequence Data (270 bps)
AGGATTTCGTGTACCAGTTTAAGGGCCTGTGCTACTTCACCAACGGGACGGAGCGCGTGCGGGGTGTGACCAGACACATC
TATAACCGAGAGGAGTACATGCGCTTCGACAGCGACGTGGGGGTGTATCGGGCGGTGACGCCGCAGGGGCGGCCTGACGC
CGAGTACTGGAACAGCCAGAAGGAAGTCCTGGAGGGGGCCCGGGCGTCGGTGGACAGAGTGTGCAGACACAACTACGAGG
TGGCGTACCGCGGGATCCTGCAGAGGAGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo