Allele Report for DQB1*05:27

DQB1*05:27 View HGVS Report
Pre-2010 Nomenclature: Local Names: 44323
IMGT/HLA Acc No: HLA09509 OMIM Entry: *604305
Assigned: 2013-04-30 Sequence Last Modified: 2013-07-12
Source Entries: HG518398 , KC776937  
Cells Sequence Derived From: 137641 , 137830 , 15732436  
Known Ethnic Origin Of Source: Caucasoid
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 3 Laboratories: 2
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (183 aa)
DFVYQFKGLCYFTNGTERVRGVTRHIYNREEYVRFDSDVGVYRAVTPQGRPVAEYWNSQKEVLEGARASVDRVCRHNYEV
AYRGILQRRVEPTVTISPSRTEALNHHNLLICSVTDFYPSQIKVRWFRNDQEEIAGVVSTPLIRNGDWTFQILVMLEMTP
QRGDVYTCHVEHPSLQSPITVEW
Nucleotide Sequence Data (552 bps)
AGGATTTCGTGTACCAGTTTAAGGGCCTGTGCTACTTCACCAACGGGACGGAGCGCGTGCGGGGTGTGACCAGACACATC
TATAACCGAGAGGAGTACGTGCGCTTCGACAGCGACGTGGGGGTGTACCGGGCAGTGACGCCGCAGGGGCGGCCTGTTGC
CGAGTACTGGAACAGCCAGAAGGAAGTCCTGGAGGGGGCCCGGGCGTCGGTGGACAGGGTGTGCAGACACAACTACGAGG
TGGCGTACCGCGGGATCCTGCAGAGGAGAGTGGAGCCCACAGTGACCATCTCCCCATCCAGGACAGAGGCCCTCAACCAC
CACAACCTGCTGATCTGCTCGGTGACAGATTTCTATCCAAGCCAGATCAAAGTCCGGTGGTTTCGGAATGATCAGGAGGA
GATAGCCGGCGTTGTGTCCACCCCCCTCATTAGGAACGGTGACTGGACCTTCCAGATCCTGGTGATGCTGGAAATGACTC
CCCAGCGTGGAGATGTCTACACCTGCCACGTGGAGCACCCCAGCCTCCAGAGCCCCATCACCGTGGAGTGGC
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo