Allele Report for DQB1*05:19

DQB1*05:19 View HGVS Report
Pre-2010 Nomenclature: Local Names: HLA-DQB1*05new
IMGT/HLA Acc No: HLA09102 OMIM Entry: *604305
Assigned: 2012-12-31 Sequence Last Modified: 2013-04-17
Source Entries: KC285590 , KF804122  
Cells Sequence Derived From: HG00007758 , KLSIS  
Known Ethnic Origin Of Source: Black
Publications
Hommel-Berrey G et al. Tissue Antigens 82:150-151 2013. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (183 aa)
DFVYQFKGLCYFTNGTERVRGVTRHIYNREEYVRFDSDVGVYREVTPQGRPSAEYWNSQKEVLEGARASVDRVCRHNYEV
AYRGILQRRVEPTVTISPSRTEALNHHNLLICSVTDFYPSHIKVRWFRNDQEETAGVVSTPLIRNGDWTFQILVMLEMTP
QRGDVYTCHVEHPSLQSPITVEW
Nucleotide Sequence Data (552 bps)
AGGATTTCGTGTACCAGTTTAAGGGCCTGTGCTACTTCACCAACGGGACGGAGCGCGTGCGGGGTGTGACCAGACACATC
TATAACCGAGAGGAGTACGTGCGCTTCGACAGCGACGTGGGGGTGTACCGGGAGGTGACGCCGCAGGGGCGGCCTAGCGC
CGAGTACTGGAACAGCCAGAAGGAAGTCCTGGAGGGGGCCCGGGCGTCGGTGGACAGAGTGTGCAGACACAACTACGAGG
TGGCGTACCGCGGGATCCTGCAGAGGAGAGTGGAGCCCACAGTGACCATCTCCCCATCCAGGACAGAGGCCCTCAACCAC
CACAACCTGCTGATCTGCTCGGTGACAGATTTCTATCCAAGCCACATCAAAGTCCGGTGGTTTCGGAATGATCAGGAGGA
GACAGCCGGCGTTGTGTCCACCCCCCTCATTAGGAACGGTGACTGGACCTTCCAGATCCTGGTGATGCTGGAAATGACTC
CCCAGCGTGGAGATGTCTACACCTGCCACGTGGAGCACCCCAGCCTCCAGAGCCCCATCACCGTGGAGTGGC
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo