Allele Report for DQB1*05:17

DQB1*05:17 View HGVS Report
Pre-2010 Nomenclature: Local Names: HLA-DQB1*05 variant
IMGT/HLA Acc No: HLA08596 OMIM Entry: *604305
Assigned: 2012-09-30 Sequence Last Modified: 2012-10-17
Source Entries: JX494227  
Cells Sequence Derived From: C149354  
Known Ethnic Origin Of Source: Oriental
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (183 aa)
DFVYQFKGLCYFTNGTERVRGVTRHIYNREEYVRFDSDVGVYRAVTPQGRPSAEYWNSQKEVLEGARASVDRVCRHNYEV
AYRGILQRRVEPTVTISPSRTEALNHHNLLICSVTDFYPSHIKVRWFRNDQEETAGVVSTPLIRNGDWTFQTLVMLEMTP
QRGDVYTCHVEHPSLQSPITVEW
Nucleotide Sequence Data (552 bps)
AGGATTTCGTGTACCAGTTTAAGGGCCTGTGCTACTTCACCAACGGGACGGAGCGCGTGCGGGGTGTGACCAGACACATC
TATAACCGAGAGGAGTACGTGCGCTTCGACAGCGACGTGGGGGTGTACCGGGCGGTGACGCCGCAGGGGCGGCCTAGCGC
CGAGTACTGGAACAGCCAGAAGGAAGTCCTGGAGGGGGCCCGGGCGTCGGTGGACAGAGTGTGCAGACACAACTACGAGG
TGGCGTACCGCGGGATCCTGCAGAGGAGAGTGGAGCCCACAGTGACCATCTCCCCATCCAGGACAGAGGCCCTCAACCAC
CACAACCTGCTGATCTGCTCGGTGACAGATTTCTATCCAAGCCACATCAAAGTCCGGTGGTTTCGGAATGATCAGGAGGA
GACAGCCGGCGTTGTGTCCACCCCCCTCATTAGGAACGGTGACTGGACCTTCCAGACCCTGGTGATGCTGGAAATGACTC
CCCAGCGTGGAGATGTCTACACCTGCCACGTGGAGCACCCCAGCCTCCAGAGCCCCATCACCGTGGAGTGGC
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo