Allele Report for DQB1*05:15

DQB1*05:15 View HGVS Report
Pre-2010 Nomenclature: Local Names: HLA-DQB1
IMGT/HLA Acc No: HLA07929 OMIM Entry: *604305
Assigned: 2012-04-24 Sequence Last Modified: 2012-07-12
Source Entries: JQ828988  
Cells Sequence Derived From: H12038  
Known Ethnic Origin Of Source: Oriental
CWD v2.0 Status: Not defined
Publications
Han ZD et al. Tissue Antigens 84:246-248 2014. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (183 aa)
DFVYQFKGLCYFTNGTERVRGVTRHIYNREEYVRFDSDVGVYRAVTPQGRPDAEYWNSQKEVLEGARASVDRVCKHNYEV
AYRGILQRRVEPTVTISPSRTEALNHHNLLICSVTDFYPSQIKVRWFRNDQEETAGVVSTPLIRNGDWTFQILVMLEMTP
QRGDVYTCHVEHPSLQSPITVEW
Nucleotide Sequence Data (552 bps)
AGGATTTCGTGTACCAGTTTAAGGGCCTGTGCTACTTCACCAACGGGACGGAGCGCGTGCGGGGTGTGACCAGACACATC
TATAACCGAGAGGAGTACGTGCGCTTCGACAGCGACGTGGGGGTGTATCGGGCGGTGACGCCGCAGGGGCGGCCTGACGC
CGAGTACTGGAACAGCCAGAAGGAAGTCCTGGAGGGGGCCCGGGCGTCGGTGGACAGAGTGTGCAAACACAACTACGAGG
TGGCGTACCGCGGGATCCTGCAGAGGAGAGTGGAGCCCACAGTGACCATCTCCCCATCCAGGACAGAGGCCCTCAACCAC
CACAACCTGCTGATCTGCTCGGTGACAGATTTCTATCCAAGCCAGATCAAAGTCCGGTGGTTTCGGAATGATCAGGAGGA
GACAGCCGGCGTTGTGTCCACCCCCCTCATTAGGAACGGTGACTGGACCTTCCAGATCCTGGTGATGCTGGAAATGACTC
CCCAGCGTGGAGATGTCTACACCTGCCACGTGGAGCACCCCAGCCTCCAGAGCCCCATCACCGTGGAGTGGC
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo