Allele Report for DQB1*05:04

DQB1*05:04 View HGVS Report
Pre-2010 Nomenclature: DQB1*0504 Local Names: DQB1.9
IMGT/HLA Acc No: HLA00642 OMIM Entry: *604305
Assigned: 1990-11-04 Sequence Last Modified: 2014-04-14
Source Entries: HG795013 , M65046 , M94773  
Cells Sequence Derived From: DG , R.F. , R49831  
Known Ethnic Origin Of Source: Caucasoid
Publications
Bugawan TL et al. Immunogenetics 33:163-70 1991. (View abstract)
Fenske TS et al. Tissue Antigens 40:49-52 1992. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 3 Laboratories: 3
HLA Dictionary Data
Expert Assigned Type: DQ5 WHO Assigned Type: DQ5(1)
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 1 DQ1 [66%] DQ5 [23%] DQ6 [8%]
NMDP (2008) 48 DQ5 [58%] DQ1 [17%] DQ6 [2%]
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DQ5
Comments:
Protein Sequence (89 aa)
DFVYQFKGLCYFTNGTERVRGVTRYIYNREEYVRFDSDVGVYRAVTPQGRPSAEYWNSQKDILEEDRASVDRVCRHNYEV
AYRGILQRR
Nucleotide Sequence Data (270 bps)
AGGATTTCGTGTACCAGTTTAAGGGCCTGTGCTACTTCACCAACGGGACGGAGCGCGTGCGGGGTGTGACCAGATACATC
TATAACCGAGAAGAGTACGTGCGCTTCGACAGCGACGTGGGGGTGTACCGGGCGGTGACGCCGCAGGGGCGGCCTAGCGC
CGAGTACTGGAACAGCCAGAAGGACATCCTGGAGGAGGACCGGGCGTCGGTGGACAGGGTGTGCAGACACAACTACGAGG
TGGCGTACCGCGGGATCCTGCAGAGGAGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo