Allele Report for DQB1*04:10

DQB1*04:10 View HGVS Report
Pre-2010 Nomenclature: Local Names: HLA-DQB1
IMGT/HLA Acc No: HLA09137 OMIM Entry: *604305
Assigned: 2013-01-29 Sequence Last Modified: 2013-07-12
Source Entries: AB773253  
Cells Sequence Derived From: SH004  
Known Ethnic Origin Of Source: Oriental
Publications
Oka S et al. Tissue Antigens 82:148-149 2013. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
DFVFQFKGMCYFTNGTERVRGVTRYIYNREEYARFDSDVGVYRAVTPQGRPDAEYWNSQKDILEEDRASVDTVCRHNYQL
ELRTTLQRR
Nucleotide Sequence Data (270 bps)
AGGATTTCGTGTTCCAGTTTAAGGGCATGTGCTACTTCACCAACGGGACCGAGCGCGTGCGGGGTGTGACCAGATACATC
TATAACCGAGAGGAGTACGCGCGCTTCGACAGCGACGTGGGGGTGTATCGGGCGGTGACGCCGCAGGGGCGGCCTGATGC
CGAGTACTGGAATAGCCAGAAGGACATCCTGGAGGAGGACCGGGCGTCGGTGGACACCGTATGCAGACACAACTACCAGT
TGGAGCTCCGCACGACCTTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo