Allele Report for DQB1*04:02:04

DQB1*04:02:04 View HGVS Report
Pre-2010 Nomenclature: Local Names: HIS_NEW_DQB1_110490_00317
IMGT/HLA Acc No: HLA09745 OMIM Entry: *604305
Assigned: 2013-06-26 Sequence Last Modified: 2013-07-12
Source Entries: KC859263 , KF471735 , KF673220 , KJ437180  
Cells Sequence Derived From: HG00005888 , HG00007650 , HG00007651 , HG00008973  
Known Ethnic Origin Of Source: Unknown
CWD v2.0 Status: Not defined
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 4 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
DFVFQFKGMCYFTNGTERVRGVTRYIYNREEYARFDSDVGVYRAVTPLGRLDAEYWNSQKDILEEDRASVDTVCRHNYQL
ELRTTLQRR
Nucleotide Sequence Data (270 bps)
AGGATTTCGTGTTCCAGTTTAAGGGCATGTGCTACTTCACCAACGGGACCGAGCGCGTGCGGGGTGTGACCAGATACATC
TATAACCGAGAGGAGTACGCGCGCTTCGACAGCGACGTGGGGGTGTATCGGGCGGTGACGCCGCTGGGGCGGCTTGACGC
CGAGTACTGGAATAGTCAGAAGGACATCCTGGAGGAGGACCGGGCGTCGGTGGACACCGTATGCAGACACAACTACCAGT
TGGAGCTCCGCACGACCTTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo