Allele Report for DQB1*04:04

DQB1*04:04 View HGVS Report
Pre-2010 Nomenclature: DQB1*0404 Local Names: HLA-DQB1*04new
IMGT/HLA Acc No: HLA04390 OMIM Entry: *604305
Assigned: 2009-10-31 Sequence Last Modified: 2010-01-15
Source Entries: FN555147  
Cells Sequence Derived From: 195212  
Known Ethnic Origin Of Source: Caucasoid
CWD v2.0 Status: Not defined
Publications
Witter K et al. Tissue Antigens 76:256-258 2010. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
DFVYQFKGMCYFTNGTERVRGVTRYIYNREEYARFDSDVGVYRAVTPLGRLDAEYWNSQKDILEEDRASVDTVCRHNYQL
ELRTTLQRR
Nucleotide Sequence Data (270 bps)
AGGATTTCGTGTACCAGTTTAAGGGCATGTGCTACTTCACCAACGGGACCGAGCGCGTGCGGGGTGTGACCAGATACATC
TATAACCGAGAGGAGTACGCGCGCTTCGACAGCGACGTGGGGGTGTATCGGGCGGTGACGCCGCTGGGGCGGCTTGACGC
CGAGTACTGGAATAGCCAGAAGGACATCCTGGAGGAGGACCGGGCGTCGGTGGACACCGTATGCAGACACAACTACCAGT
TGGAGCTCCGCACGACCTTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo