Allele Report for DQB1*04:03:01

DQB1*04:03:01 View HGVS Report
Pre-2010 Nomenclature: DQB1*040301 Local Names: HLA-DQB1*04var
IMGT/HLA Acc No: HLA03234 OMIM Entry: *604305
Assigned: 2008-02-27 Sequence Last Modified: 2008-04-08
Source Entries: EU410617  
Cells Sequence Derived From: 06222422  
Known Ethnic Origin Of Source: Unknown
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
DFVFQFKGMCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRAVTPLGRLDAEYWNSQKDILEEDRASVDTVCRHNYQL
ELRTTLQRR
Nucleotide Sequence Data (270 bps)
AGGATTTCGTGTTCCAGTTTAAGGGCATGTGCTACTTCACCAACGGGACCGAGCGCGTGCGTCTTGTGACCAGATACATC
TATAACCGAGAGGAGTACGCGCGCTTCGACAGCGACGTGGGGGTGTATCGGGCGGTGACGCCGCTGGGGCGGCTTGACGC
CGAGTACTGGAATAGCCAGAAGGACATCCTGGAGGAGGACCGGGCGTCGGTGGACACCGTATGCAGACACAACTACCAGT
TGGAGCTCCGCACGACCTTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo