Allele Report for DQB1*03:74

DQB1*03:74 View HGVS Report
Pre-2010 Nomenclature: Local Names: HIS_NEW_DQB1_110473_00297
IMGT/HLA Acc No: HLA09635 OMIM Entry: *604305
Assigned: 2013-05-29 Sequence Last Modified: 2013-07-12
Source Entries: KC632182  
Cells Sequence Derived From: HG00005860  
Known Ethnic Origin Of Source: Unknown
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
DFVYQFKAMCYFTNGTERVRLVTRYIYNREEYARFDSDVEVYRAVTPLGPPDAEYWNSQKEVLERTRAELDTVCRHNYQL
ELRTTLQRR
Nucleotide Sequence Data (270 bps)
AGGATTTCGTGTACCAGTTTAAGGCCATGTGCTACTTCACCAACGGGACGGAGCGCGTGCGTCTTGTGACCAGATACATC
TATAACCGAGAGGAGTACGCACGCTTCGACAGCGACGTGGAGGTGTACCGGGCGGTGACGCCGCTGGGGCCGCCTGACGC
CGAGTACTGGAACAGCCAGAAGGAAGTCCTGGAGAGGACCCGGGCGGAGTTGGACACGGTGTGCAGACACAACTACCAGT
TGGAGCTCCGCACGACCTTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo