Allele Report for DQB1*03:45

DQB1*03:45 View HGVS Report
Pre-2010 Nomenclature: Local Names: DQB1*03:02 NOVEL ALLELE
IMGT/HLA Acc No: HLA08955 OMIM Entry: *604305
Assigned: 2012-11-30 Sequence Last Modified: 2013-01-18
Source Entries: KC019968 , KC119454 , KF647802 , KF737218 , KF925410  
Cells Sequence Derived From: 98511 , HG00005538 , HG00007635 , HG00008167 , HG00008168  
Known Ethnic Origin Of Source: Caucasoid
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 5 Laboratories: 2
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (183 aa)
DFVYQFKGMCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRAVTPLGPPAAEYWNSQKEVLERTRADLDTVCRHNYQL
ELRTTLQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSTPLIRNGDWTFQILVMLEMTP
QRGDVYTCHVEHPSLQNPIIVEW
Nucleotide Sequence Data (552 bps)
AGGATTTCGTGTACCAGTTTAAGGGCATGTGCTACTTCACCAACGGGACGGAGCGCGTGCGTCTTGTGACCAGATACATC
TATAACCGAGAGGAGTACGCACGCTTCGACAGCGACGTGGGGGTGTATCGGGCGGTGACGCCGCTGGGGCCGCCTGCCGC
CGAGTACTGGAACAGCCAGAAGGAAGTCCTGGAGAGGACCCGGGCGGACTTGGACACGGTGTGCAGACACAACTACCAGT
TGGAGCTCCGCACGACCTTGCAGCGGCGAGTGGAGCCCACAGTGACCATCTCCCCATCCAGGACAGAGGCCCTCAACCAC
CACAACCTGCTGGTCTGCTCAGTGACAGATTTCTATCCAGCCCAGATCAAAGTCCGGTGGTTTCGGAATGACCAGGAGGA
GACAACTGGCGTTGTGTCCACCCCCCTTATTAGGAACGGTGACTGGACCTTCCAGATCCTGGTGATGCTGGAAATGACTC
CCCAGCGTGGAGACGTCTACACCTGCCACGTGGAGCACCCCAGCCTCCAGAACCCCATCATCGTGGAGTGGC
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo