Allele Report for DQB1*03:10:02

DQB1*03:10:02 View HGVS Report
Pre-2010 Nomenclature: Local Names: HIS_NEW_DQB1_110523_00411, HIS_NEW_DQB1_110490_00319
IMGT/HLA Acc No: HLA10276 OMIM Entry: *604305
Assigned: 2013-10-31 Sequence Last Modified: 2014-01-17
Source Entries: KC859265 , KF015559 , KF184350 , KF381255 , KF695007 , KF737211  
Cells Sequence Derived From: HG00006099 , HG00006100 , HG00008135 , HG00008136 , HG00008137 , HG00008138  
Known Ethnic Origin Of Source: Unknown
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 6 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
DFVYQFKAMCYFTNGTERVRYVTRYIYNREEYARFDSDVGVYRAVTPLGPPDAEYWNSQKEVLERTRAELDTVCRHNYQL
ELRTTLQRR
Nucleotide Sequence Data (270 bps)
AGGATTTCGTGTACCAGTTTAAGGCCATGTGCTACTTCACCAACGGGACGGAGCGCGTGCGTTATGTGACCAGATACATC
TATAACCGAGAGGAGTACGCACGCTTCGACAGCGACGTGGGGGTGTACCGGGCGGTGACGCCGCTGGGGCCGCCTGACGC
CGAGTACTGGAACAGCCAGAAGGAAGTCCTGGAGAGGACCCGGGCGGAGTTGGACACGGTGTGCAGACACAACTACCAGT
TGGAGCTCCGCACGACCTTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo