Allele Report for DQB1*03:05:01

DQB1*03:05:01 View HGVS Report
Pre-2010 Nomenclature: DQB1*030501 Local Names: DQB1*03051, DQB1*03KC
IMGT/HLA Acc No: HLA00631 OMIM Entry: *604305
Assigned: 1992-12-15 Sequence Last Modified: 2011-04-08
Source Entries: BX248406 , X69169 , X76554  
Cells Sequence Derived From: G.P. , M.A.  
Known Ethnic Origin Of Source: Caucasoid
Publications
Cucca F et al. Tissue Antigens 41:263-6 1993. (View abstract)
Cucca F et al. Hum Immunol 40:143-9 1994. (View abstract)
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
HLA Dictionary Data
Expert Assigned Type: DQ8 WHO Assigned Type: DQ8(3)
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) 70 DQ8 [34%] DQ3 [30%]
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DQ8
Comments:
Protein Sequence (261 aa)
MSWKKALRIPGGLRVATVTLMLAMLSTPVAEGRDSPEDFVYQFKGMCYFTNGTERVRGVTRYIYNREEYARFDSDVGVYR
AVTPLGPPAAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIK
VRWFRNDQEETTGVVSTPLIRNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQNPIIVEWRAQSESAQSKMLSGIGGFVL
GLIFLGLGLIIHHRSQKGLLH
Nucleotide Sequence Data (786 bps)
ATGTCTTGGAAGAAGGCTTTGCGGATCCCTGGAGGCCTTCGGGTAGCAACTGTGACCTTGATGCTGGCGATGCTGAGCAC
CCCGGTGGCTGAGGGCAGAGACTCTCCCGAGGATTTCGTGTACCAGTTTAAGGGCATGTGCTACTTCACCAACGGGACCG
AGCGCGTGCGGGGTGTGACCAGATACATCTATAACCGAGAGGAGTACGCGCGCTTCGACAGCGACGTGGGGGTGTATCGG
GCGGTGACGCCGCTGGGGCCGCCTGCCGCCGAGTACTGGAACAGCCAGAAGGAAGTCCTGGAGAGGACCCGGGCGGAGTT
GGACACGGTGTGCAGACACAACTACCAGTTGGAGCTCCGCACGACCTTGCAGCGGCGAGTGGAGCCCACAGTGACCATCT
CCCCATCCAGGACAGAGGCCCTCAACCACCACAACCTGCTGGTCTGCTCAGTGACAGATTTCTATCCAGCCCAGATCAAA
GTCCGGTGGTTTCGGAATGACCAGGAGGAGACAACTGGCGTTGTGTCCACCCCCCTTATTAGGAACGGTGACTGGACCTT
CCAGATCCTGGTGATGCTGGAAATGACTCCCCAGCGTGGAGACGTCTACACCTGCCACGTGGAGCACCCCAGCCTCCAGA
ACCCCATCATCGTGGAGTGGCGGGCTCAGTCTGAATCTGCCCAGAGCAAGATGCTGAGTGGCATTGGAGGCTTCGTGCTG
GGGCTGATCTTCCTCGGGCTGGGCCTTATTATCCATCACAGGAGTCAGAAAGGGCTCCTGCACTGA
Genomic Sequence Data (6934 bps)
TGAATCGCATTTTTCTTTGGCTTCTTAAAATCCCTTAGGCATTCAATCTTCAGCTCTTCTATAATTGAGAGGAAGTTTTC
ACCTCAAATGTTCATCCAGTGCAATTTGAAGACGTCACAGTGCCAGGGACTGGATTGAGAACCTTCACAAAAAAAAATGT
CTGCCTAGAGACAGATTAGGTCCTTCAGCTCCAGTGCTGATTGGTTCCTTTCCAAAGGACCATCCAATCCTGCCACGCAG
GGAAACATCCACAGGTTTTTATTCTTTCTGCCAGGTACATCAGATCCATCAGGTCCAAGCTGTGTTGACTACCACTACTT
TTCCCTTCGTCTCAATTATGTCTTGGAAGAAGGCTTTGCGGATCCCTGGAGGCCTTCGGGTAGCAACTGTGACCTTGATG
CTGGCGATGCTGAGCACCCCGGTGGCTGAGGGCAGAGACTCTCCCGGTAAGTGCAGGGCCACTGCTCTCCAGAGCCGCCA
CTCTGGGAACAGGCTCTCCTTGGGCTGGGGTAGGGGGATGGTGATCTCCATGATCTCGGACACAATCTTTCATCAACATT
TCCTCTCTTTGGGGAAAGAGAACGATGTTGCATTCCCATTTATCTTTTAGTGATGAGGTGAGCACAGTCGGATCCCCATC
CTACAGGCTTAAGCCTGGAAGAGAAGGAGAGAGGAGAGGAAAGAGGAGACAAAGTGTACATTTACTACCAGTGACAGGAC
AAAGTGAGCATGGGGTTATTTTTGAAGATACGAATTTCTCCAGAGACACAGCAGGATTTGTCATTTAGGCGTGCCCCAAG
ACTTTGCCTGGACTAAATATTATGGGATCCTGCATTGGGAAATGTAAGGCAGCAATGGTGTCTGTAGTCTCCGTATTTGA
GGAAAAGTTGTCTGTATTCCTGACTGACTGGAGCGTTTGTGGAGGCAAAATCTTGGTACTGAAGGAAGCTGACTGGATGA
CCACAGACAGGGAGTCTTCAGGTTTCACTGATTTATGGGCAAATGGTGACTTGAGTGGGATTCAGAGACCCGAGTTGGTG
GACTGAATTTAGCAGAAAGGAGGATGTAAAGAAGGGAAATAACATATATTGTGAAACCACTCATTTCAGACACAGCACAA
TACTTTACATAAATTCTCTCTCACTCCTTCTAACATCCTGTGTGTAGATATCATGATTTTCTTTTACACAATTATACTTG
TGATATGGATATTCTGTTACATACCTGCCCTAGCTGGTGACTGCCACAGCTTAATTGGAATCTAGTTTATCAAATTCAAA
AGCTTGTGCTCTTTCCATGAATAAATGTTTCTTTCTAGGACTCGGAGGTGTAGGTCCTTTCTAACATAAAAGTGAGTGAA
CCTCACATGGCATTCGGAAGGGTAAATCCAGGCATGGGAAGGGAGGTATTTTACCGAGGGACCAAGAGAATACGCATATC
AGAACGAGGACAGGCTTAATTTCTGGACCCGTCTCATCATTCCCTTGAACTCACAGGTTTATGTGGATAATTTTATCTCT
GAGGTTTCCAGGAGCTCAATGGAAAATGGGATTTCATGCGAGAGCGCCCTGATTCCCTCTAAGTGCAGAGGTCTATGTAA
AATCAGCCCGACTGCCTCTTCCCTCGGTTCACAGGCTCCGGCAGGGACAGGGCTTTCCGCCCTTTCCTGCCTGCAGGAAG
GCGGATTCCCGAAGCCCCCAGAGAGGGCGGGCAGGGCTGGGCAGAGCCGCCGGGCGGATCACAAGTCTGGAGCGCCAGGC
ACGGGCGGGCGGGAACTGGAGGTCGCGCGGGCGGTTCCACAGCTCCGGGCCGGGTCAGGGCGGCGGCTGCGGGGGCGGCC
GGGCTGGGGCCGGGCCGGGGCCTGACTGACCGGCCGGTGATTCCCCGCAGAGGATTTCGTGTACCAGTTTAAGGGCATGT
GCTACTTCACCAACGGGACCGAGCGCGTGCGGGGTGTGACCAGATACATCTATAACCGAGAGGAGTACGCGCGCTTCGAC
AGCGACGTGGGGGTGTATCGGGCGGTGACGCCGCTGGGGCCGCCTGCCGCCGAGTACTGGAACAGCCAGAAGGAAGTCCT
GGAGAGGACCCGGGCGGAGTTGGACACGGTGTGCAGACACAACTACCAGTTGGAGCTCCGCACGACCTTGCAGCGGCGAG
GTGAGCGTCGTCGCCCGTCTGCGAGGCCCATCCTTGGCAGGGGCCCAGAGTCTCTGCGCCAGGAGGGGCGAAGGGGGCGC
GGCCTCTGGAACCTGAGCCTTGTTCGTTCCACCCCGGCTGACAGGAGGAGGCGGTGGGGGTGCTGGGGGCTGGTGCATCG
GAGGGGCAGGGACCTAGGGCAGAGCAGGGGGACAGGCAGAGTTGGTCAAGCTGCCTAGTTTCGCCCCATCCTCCCCGTCC
GTCGGCCTCGCCCTCTGCTCTGCACGTTCTTGCCTCGTGCCTTATGCGTTTGCCTCCTCGTGCCTTACCTTTACTAAGCA
GTTCTCTCTGCCCCCAATTTCCGCCCTCTTCCCCTGCCCGCCCGCCCGGCTAGCACTGCCGCACCCGGCAAGGTCCACCT
ACACAGCTCATGCAGTGGGAAGCTTCAGACTTGGCCTGATGGAGTTAGGGCTGCCCCACAACTGCGCGCAGGGCATCCAG
CAATTACAGTTGTCAAATAAGATATTTTGACTTTTGACTTCAAATTATTATTCATCGTAATTCTGTTTTCTTAAATGGCT
CTCATTCATGGCGGAGCTCTTTGAGATGAGAGTGTTTTAATCATTGCATGCCTGGTATCTGACACATTGACTGGCATGTG
GTATGAGCTCAATGATCTTCTGTTAAATTAATGAATAAATGTGCTCAGCTGCCAATCCACTTAGGCTCAAGGGAAAGCAG
AGGATAAATAGAGCCTTAAAAATGGACTTTTATTAATTATTTTCTGTCATTTTGCTTAATTCTTTAAAGTAAACTCTTAT
TGACTTGGATCTTAATAGAGTTTGTGAATACAAAGTCTGAGGAAAAAAGTGTTTGCTAAAAATAAAAACAACACTTGAAT
GATGTTTGTAAGGCAGTTTTAATTTCTTAGAAAAGCTGAACAAATGGCACAATGCAAAGAGCAGAAGTTTTGGAATAAAT
AGATTGAAGCAATTAAATTATTGGATAAAAATAGTTTCAGGTTGCTTTTGGCTTAGGTTCTCCCCTCCCCCCATCACTAT
CCACTTCAGGAATAAACATTCTGAAAGTCAATTTTACCCATTTAGTGAGCACTTATTTCTAGACAGTTACCTTATCAAAT
ACCGTCTATGTTACGTCATTTAATCTCACAGTTGCCTGTGCATTAGAGATTAGCATCACCACTTTATATATCCTAATATT
AGTACATGACAAACACTTTAAGTAATCAGCCCACAAGTACTCACCAAGACCTTAAGCCTCCCAAAGTACACAATATTCTT
TATGTTCTTCACTACACATCTATAGAGTCAAAGGGACATAAAGCCTTGTTAAAGCCAGTTTTGACTAGAAGCAGCAATGA
GTCTCTTCCTGTTTGATCTCCATGTTAATGGGACAAAATGATACTTTCAAGGCATTGAAAATTTATGATTAATCAATCCC
TAGTCTGACTCCAGTGTTACCTATGCAGATTCACAAAACTTTTAGTTTACTTTAAACTCCCTTGCCTTCTTTTGACTCAC
ATCGTAGTGCCAGCAAGTACTTACATTTTTGCTATTTTGGTTCTATTTCCATAAAATTTATTTTATCATCTTTTCTCATA
AGTTTGTGCCCTCTATTTTACTCCCAGTCTGTGTAAGATGAACAAATCTTATAAGGCCACATAGCTGACTGTGATTTCAG
GTGGACTCCAGGAAGGAGAACCAAAGAAAAGTTCAAGTCCAAGCAGAAACCGTGATTCCTTCCGGATGATGGCTCAAGAG
TGCCTTTTAATTGGGGTGCAACCTGCTGACCTCAGCAAATCTCAGCTATATTTATATGTTCACATTACAGGCTCATTAAC
CTAGGCTGATCTCTGCAAGGATCTCAGAATATTTTCTACAGATAACATACATGATAATATCTGATTTCAGGACAAAAAAG
TAATTCTCAATAGCAAGGGAATGGAGTAGGGTAGACAGCTAGTAATTAAACTCACTTGTATGTTAAAAATAAATTAAGGA
AAAAAAGAAAATGAGAGAACATATTACTAAATAAAGAAAGCATACATTAAATATTTACTATAGTTTCACACTAAGAGAAT
AAAGGAAATGCAATAAAGTGGCCTGAAAGATAAAGGATGAGACGTGTAAAGAGACAGGGAAAGATGTGTCATTTTTTTAC
TATGAGCAGCAGTCTGAGAAGATAAAGGAATCGAGTTATGGGCAAACATGATGTTTGATCAGTGTTATTTGTTTTGAAGG
CCTGCCTACTTTTGTTTCAAATATTACAGACTTTTGAAATCACATTCTTTTTGTTTTTTGCTGTCTGTTACTAGATCGCA
CATTCTGTAAAGGCAGGGACCATGGTATGTTGTTTATCTTTGGATTCTCAGTGATTGTCATATTTATATTTGTTGAATGA
ATCTTAATCCAAGACTTGGACTCCAGGTATCTTTCCACTCTGGTTCCAAGGAGGGACCATTCCCAATGGTAGACGTGCTG
TGTGGTCTCACATCTCACTCCTGTCTTTTCCTGTCTGTTACTGCCCTCAGTGGAGCCCACAGTGACCATCTCCCCATCCA
GGACAGAGGCCCTCAACCACCACAACCTGCTGGTCTGCTCAGTGACAGATTTCTATCCAGCCCAGATCAAAGTCCGGTGG
TTTCGGAATGACCAGGAGGAGACAACTGGCGTTGTGTCCACCCCCCTTATTAGGAACGGTGACTGGACCTTCCAGATCCT
GGTGATGCTGGAAATGACTCCCCAGCGTGGAGACGTCTACACCTGCCACGTGGAGCACCCCAGCCTCCAGAACCCCATCA
TCGTGGAGTGGCGTAAGGGGATATTGAGTTTCTGTTACTATGGGCCCCACAAGACAAAGGGCAGAGCTCCTTCTGACCCA
TTCCTTCCCATCTCTTATCCCTGATGTCACTACTGAGCTGGGGATCACAGGAGACTAGAGCACCTCTTGCTCCATGGCAA
GTGCATCAGAAGAATCCTGATCTCATCACCTTTCCAGATGCTAGGGAAATTATTCTACGTACTGTTTCTCCAGATCCCAG
TCCTGATAGCTCGGAGGGACTTATTATTAGGGCTGGTGACTGGGATCTTAGGGTTTAAGGTATGGATGAGTTCCTGAGGA
GTGGAGATCTGCTTCCCCGCTCTCTCACCTACTCACTATACCGAAGGACCTATTGGCTGGCTTTCCCCTCCCTTAGGGGT
GGTCTGAATGGAGGACTAGGTTCCTTTGACACTTTCACCTCCTGCATCTCAGACTGGACTTCAGCTCCTCAGCAGGGATG
CTATGGGGTGTAGGGACAAACGCTGACACTCAGGCTCTGCTTCTTAGGGGCTCAGTCTGAATCTGCCCAGAGCAAGATGC
TGAGTGGCATTGGAGGCTTCGTGCTGGGGCTGATCTTCCTCGGGCTGGGCCTTATTATCCATCACAGGAGTCAGAAAGGT
GAGGAACCCCAAGGGAAAAGGGGAAGATGGGCTGTGACCCAGACCCTCTGTTCAGGGAGGTCCTGTCTCTAGATGTGGCT
CTTTCCTCCTGACCCTGAGAGGAAGAAAACTGAGCTGGAGGTGGGAGGAGACAGGACAAGATTGGAGGAGGCATTGGAAT
CTGATTTTACTAGTTGAAAGGTAGCCCTGTCACACAGGTGACTGATAGAGCTTATTCCAGGATATACTTACCATTCATCA
TCTCATTGGCTCCTTTCCAAAAGCTTCCTCCATTAAGAGGGTCAGAGCCTTGGCCTCCTTGCCTTCTAGTGACAATTTTC
TTTGTTTTAGGGGATTTTAAATTAGGGTACTTAAGGCCTTGAAGAACATGAGTGGTAAGAGAATATAACTCTAATTAAGT
CACATGTGTCATTTTCCTTTGGGGTGAAAGAGTGGCTGTTTGTGTAATGAGACCTTTCTCTGCATAACTTCCTTTTGTAA
GACCTCAAGGGCCTCCACCAGCAGGTGATATTTCAGCCATGAGCCAGTGTGGGGGGGCACAGGTGTAAGAGGGAAGAGCA
TGAGCTGAATGCACCTGACCACAATGGTCTCTGTTCATGGTATATTTGCTGCTATGAGGATCAAGACTTAGGGTCGAAGT
TTGCCAGTTTCTAGGAATCTCCAGAGGTTGTTCCCCAGAACCAAGCCTTAACTTTGGTGGTATCTTCTTGTGAAATGTGA
AGCCAGAACCACAGCTTAAATGTTAGACAAGAGGATGATGCCCACTTTGTGCCACATGTTGGTGGCTACTGCCTGTAGGC
ATTTTCCAGTGACTGAAAGAGGCTGCTAGTGGTAGGGATGAGGTATCATCCAATTTTCTAAAAAGATTGAACCCTTCATA
TTCCCCAGAAGAGTAACAGCTGTTCCGCCACTTCCCACATATCTGCATCAAGCTGAAGTTCTGTGTCCTCACGAGCTGAT
TTCACCTTTGCACAGATCTTGCGGGAGGTGACAATAATACATTCTGGACCTCAGCTTTCTCTGTCTGAAGCTGCAGGGGG
CCCCTGAGGGGTGGGGGAGATTGCAGGCCCACCAGCGTACCCTGTGCTGATCATCCCTCTTCTCTCTTCTTCAGGGCTCC
TGCACTGACTCCTGAGACTATTTTAACTGGGATTGGTTATCACTTTTCTGTAACGCCTGCTTGTCCCTGCCCAGAATTCC
CAGCTGCCTGTGTCAGCCTGTCCCCCTGAGATCAGAGTCCTACAGTGGCTGTCACGCAGCCACCAGGTCATCTCCTTTCA
TCCCCACCTCGAGGCTGATGGCTGTGACCCTGCTTCCTGCACTTACCCAGAGCC

IMGT/HLA

Sponsors

Animated Sponsors Logo