Allele Report for DQB1*03:01:22

DQB1*03:01:22 View HGVS Report
Pre-2010 Nomenclature: Local Names: HIS_NEW_DQB1_110529_00420
IMGT/HLA Acc No: HLA10540 OMIM Entry: *604305
Assigned: 2013-11-29 Sequence Last Modified: 2014-01-17
Source Entries: KF036224 , KF925406 , KJ094073  
Cells Sequence Derived From: HG00006312 , HG00008129 , HG00008130  
Known Ethnic Origin Of Source: Unknown
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 3 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
DFVYQFKAMCYFTNGTERVRYVTRYIYNREEYARFDSDVEVYRAVTPLGPPDAEYWNSQKEVLERTRAELDTVCRHNYQL
ELRTTLQRR
Nucleotide Sequence Data (270 bps)
AGGATTTCGTGTACCAGTTTAAGGCCATGTGCTACTTCACCAACGGGACGGAGCGCGTGCGTTATGTGACCAGATACATC
TATAACCGAGAGGAGTACGCACGCTTCGACAGCGACGTGGAGGTGTACCGGGCGGTGACGCCGCTGGGGCCGCCTGACGC
CGAGTACTGGAACAGCCAGAAGGAAGTCCTGGAGAGGACCCGGGCGGAGTTGGACACGGTGTGCAGACACAACTACCAGC
TGGAGCTCCGCACGACCTTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo