Allele Report for DQB1*03:01:01:03

DQB1*03:01:01:03 View HGVS Report
Pre-2010 Nomenclature: Local Names: DQB1*03:01:01:XX
IMGT/HLA Acc No: HLA06616 OMIM Entry: *604305
Assigned: 2011-02-28 Sequence Last Modified: 2011-04-08
Source Entries: AY663397 , AY663412  
Alignment of CDS Source Entries
DQB1*05:01:01:01

Locus Reference
  Virtual entry for DQB1*03:01:01:03 
  Individual submission(s) 

This feature is not currently available for some submissions of this allele.
Cells Sequence Derived From: NA00576 , NA01960  
Known Ethnic Origin Of Source: Caucasoid, Oriental
CWD v2.0 Status: Not defined
ISO OID: 2.16.840.1.113883.13.252 (HL7 Registered Organisational OID)
2.16.840.1.113883.13.252.1.1.6616 (Allele OID)
Publications
Raymond CK et al. Genome Res 15:1250-7 2005. (View abstract)
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 2 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (261 aa)
MSWKKALRIPGGLRAATVTLMLAMLSTPVAEGRDSPEDFVYQFKAMCYFTNGTERVRYVTRYIYNREEYARFDSDVEVYR
AVTPLGPPDAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIK
VRWFRNDQEETTGVVSTPLIRNGDWTFQILVMLEMTPQHGDVYTCHVEHPSLQNPITVEWRAQSESAQSKMLSGIGGFVL
GLIFLGLGLIIHHRSQKGLLH
Nucleotide Sequence Data (786 bps)
ATGTCTTGGAAAAAGGCTTTGCGGATCCCCGGAGGCCTTCGGGCAGCAACTGTTACCTTGATGCTGGCGATGCTGAGCAC
CCCAGTGGCTGAGGGCAGAGACTCTCCCGAGGATTTCGTGTACCAGTTTAAGGCCATGTGCTACTTCACCAACGGGACGG
AGCGCGTGCGTTATGTGACCAGATACATCTATAACCGAGAGGAGTACGCACGCTTCGACAGCGACGTGGAGGTGTACCGG
GCGGTGACGCCGCTGGGGCCGCCTGACGCCGAGTACTGGAACAGCCAGAAGGAAGTCCTGGAGAGGACCCGGGCGGAGTT
GGACACGGTGTGCAGACACAACTACCAGTTGGAGCTCCGCACGACCTTGCAGCGGCGAGTGGAGCCCACAGTGACCATCT
CCCCATCCAGGACAGAGGCCCTCAACCACCACAACCTGCTGGTCTGCTCAGTGACAGATTTCTATCCAGCCCAGATCAAA
GTCCGGTGGTTTCGGAATGACCAGGAGGAGACAACCGGCGTTGTGTCCACCCCCCTTATTAGGAACGGTGACTGGACCTT
CCAGATCCTGGTGATGCTGGAAATGACTCCCCAGCATGGAGACGTCTACACCTGCCACGTGGAGCACCCCAGCCTCCAGA
ACCCCATCACCGTGGAGTGGCGGGCTCAGTCTGAATCTGCCCAGAGCAAGATGCTGAGTGGCATTGGAGGCTTCGTGCTG
GGGCTCATCTTCCTCGGGCTGGGCCTTATTATCCATCACAGGAGTCAGAAAGGGCTCCTGCACTGA
Genomic Sequence Data (7231 bps)
TTCTAAGAACCTTGCTTTTTTCACCAAAACTTAAGGCTCCTCAAAGTGTGTCTAAGACAACAGCAGTAAAAATGTCTATG
ACAGCAATTTTCTCTCCCCTGAAATATGATCCCCACTTAATTTGCCCTATTGAAAGAATCCCAAGTATGAAAACAACTGG
TTTTTAATCAATATTACAAAGATGTTTACTGTTGAATCGCATTTTTTTTGGCTTCTTAAAATCCCTTAGGCATTCAGTCT
TCAGCTCTTCCATAATTGAGAGGAAATTTTCACCTCAAATGTTCATCCAGTGCAATTGGAAGACGTCACAGTGCCAGGCA
CTGGATTGAGAACCTTCACAAAAAAAAATCTGCCCAGAGACAGATGAGGTCCTTCAGCTCCAGTGCTGATTGGTTCCTTT
CCAAGGGACCATCCAATCCTACCACGCATGGAAACATCCACAGGTTTTTATTCTTTCTGCCAGGTACATCAGATCCATCA
GGTCCGAGCTGTGTTGACTACCACTACTTTTCCCTTCGTCTCAATTATGTCTTGGAAAAAGGCTTTGCGGATCCCCGGAG
GCCTTCGGGCAGCAACTGTTACCTTGATGCTGGCGATGCTGAGCACCCCAGTGGCTGAGGGCAGAGACTCTCCCGGTAAG
TGCAGGGCAGCTGCTCTCCAGAGCCGCCACTCTGGGAACAGACTCTCCTTGGGCTGGGGTATGGGGATGGTGATCTCGAT
TATCTCAGACACAATCTTTATCAATATTTCCTCTGTTTTGGGAAAGAGAGCTATGTTGCATTCCCATTTATCTTTTAATG
ATGAGGTGAGGACAATCCAATCCCATCCTACAGACTTAAGCCTGGAAGAGGAGAGAGGAGAGAAAAGAGGAGACAAAGTG
TTCATTTACTACCAGTGATAGGACAAAGTGAGCATGGGGTTATTTTTGAAGATATGAATTTCTCCAAAGACACAGCATGA
TTTGTCATTTAGGCGTGCCCCAAGACTGCCTGGACTAACTATTATGAGATCCTGCACTGGGAAATGTAAGGCAGCAATGG
TGTCTGTAGTCCCCGTATTTGGGGAAAAGGTGTCTGTATTCCTGACTCAGTGGAGCGTTTGTGGAGGCAAAATCTTGGTA
CTGAGGGAAGCTGACTGGCTGACCACAGACAGGGAGTCTTCAGGTTTCACTGATTTATGGGCAAATGGTGACCTGAGTGG
GATTCAGAGACCCGAGTTGATGGTGGACTAAATTTAGTAGAAAGGAGGATGTAAAGAAGAGAAATTATACATACTGTGAA
ACCACTCATTTCAGACACAGAACAATACTTTACATAAATTCTCTCTCACTCCTTCTAACATCCTGTGTGTAGATATCATG
ATTTTCTTTTACACAATTATACTTGTGACATGGATATTCTGTTACGTAACCTGCCCGAGCTGGTGACTGCCACAGTTTAA
TGGGATTCTAGTTTATCAAATTCAAAAGCTTGTGCTCTTTCAGTGAATAAACGTTTCTTTCTAGGACTCAGAGATCTAGG
ACTCCCTTCTTTCTAACACAGAAGTGAGTGAACCTCACAGGGCACTTGGGAGGGTAAATCCAGGCATGGGAAGGAAGGTA
TTTTACCCAGGGACCAAGAGAATAGGCATATCAAAAGAGGACAGGTTTAATTCCTGGACCTGTCTCGTCATTCCCTTGAA
CTCTCAGGTTTATGTGGATAACTTTATCTCTGAGGTACCCAGGAGCTCCATGGAAAATGGGATTTCATGCGAGAACGCCC
TGATCCCTCTAAGTGCAGAGGTCCATGCAAAATCAACCCGACTGCCTCTTCGCTTGGTTCACAGGCCCAGCCAGACAGGG
ACAGGGCTTTCCTCCCTTTCCTGCCTGTAGGAAGGCGGATTCCCGAAGACCCCCGAGAGGGCGGGCAGGGCTGGGCAGAG
CCCCCGGGAGGATCCCAGGTCTGCAGCGCGAGGCACGGGCCGGCGGGAACTGGAGGTCGCGCGGGCGGTTCCACAGCTCC
GGGCCGGGTCAGGGCGGCGGCTGCGGGGTGGCCGGGCTGGGGCCGGGCCGGGGCCGGACTGACCGGCCGGTGATTCCCCG
CAGAGGATTTCGTGTACCAGTTTAAGGCCATGTGCTACTTCACCAACGGGACGGAGCGCGTGCGTTATGTGACCAGATAC
ATCTATAACCGAGAGGAGTACGCACGCTTCGACAGCGACGTGGAGGTGTACCGGGCGGTGACGCCGCTGGGGCCGCCTGA
CGCCGAGTACTGGAACAGCCAGAAGGAAGTCCTGGAGAGGACCCGGGCGGAGTTGGACACGGTGTGCAGACACAACTACC
AGTTGGAGCTCCGCACGACCTTGCAGCGGCGAGGTGAGCGTCGTCGCCCCGCTGCGAGGCCCACTCTTGGCCGGGGCCCC
GAGTCTCTGCGCTAGGAGGGACGAGGGGGGCGAAGCCTCTGGAACCTGAGCCGCGTTCGTTCCACCCCAGGGGACAGGAG
TTGGCGGCGTGGGTGGTGGGGCAGGTGCATAGGAGGGGCAGGGACCTAGGGGCAGAGCAGGGGTACAGGTAGAGTTGGTC
AAACTGCCTAGTTTTGCCCCAGCCTTCCCGTCCGTCAGCCTCGCCCTCTGCTGTGCACGTTCTCGCCTCGTGCCTTATGC
GTTTGCCTCCTCGTGCCTTGCCTTTGCTAAGCAGTCCTCTCTGCCCCCAATTTCTGCCCTCTTCCCCTGCCCGCCCGCCC
CGCTAGCACTGCCCCACCCAGCAAGGTCCACGTGCACTGCTCGCGCCGCAGGAAGCTTCAGGCTTGGCCTGGTGGAGTTA
GGGCTGCTCCACAACTGTGCGCAGGGCATCCAGCAATTACAGTTGTGAAATAAGATATTTTGACTTTTGGCTTCAAATTA
TTATTCATCGTAATTCCGTTTTCTTAAATGGCTCTCATTCATGGCGGAGCTCTTTGAGGTGAGAGTGTTTTAATCATTTT
ATGGCCGGTACCTGACACATTGACTGGCATGTGGTATAAGCTCAATAATCTTCTGTTAAATTAATGAATAAATGTGCTCA
GCTGCCAATCCACTTAGGCTCAAGAAAAACCAGAGGTAAACAGAACCTTAAAAATGGACTTTTATTAATTATTTTCTATC
ATTTTGCTTAATTCTTTAAAGTAAACTCTTATTGACTTGGATCTAAATAGTTTGTGAATACAAAGTCTGAGGAAAAAAGT
GTTTGCTAAAAATAAAAACAACACTTGAATGATGTTTGTAAGGCAGTTTTAATTTCTTAGAAAAGCTGAACAAATGGCAC
AATGCAAAGAGCAGAAGTTTTGGAATAAATAGATTGAAGCCATTAAATTATTGGATAAAAATAGTTTCAGGTTGCTTTTG
GCCTAGGTTCTCCCCTCCCCCCATCACTATCCACTTCAGGAATAAACATTCTGAAAGTTAATTTTACCCATATAGTGAGC
ACTTATTTCTAAGTTGCCTTATCAAATACCATCTATGTTATGTCATTTAATCTCGCAGTTGCCTGTGCATTAGAGATTAG
CATCACCACTTTATATATCCTAATATTAGTACATGATAAACACTTTAAGTAATCAGCCCACAAGTACTCACCAAGACCTT
AAGCCTCCCAAAGTACACAACATTCTTACGTTCCTCACTACACATCTGTAGAGTCAAAGGGACATAAAGCCTTGTTAAAG
CCAGTTTTGACCAGAAGCAGCAATGGTCTCTTCCTGTTTGATCTCCATGTTAATGGGACAAAATGATACTTTCAAGGCAT
TGAAAATTTATGATTAATCAATCAAATTTATGATTAATCAATCCCTAGTCTGACTCCAGTGAGATTCACAAAACTTTCAG
TTTACTTTATACTCCCTTGCCTTCTTTTGACTCACATCATAGTGCCAGCAAGTACTTATATTTTTGCTATTTCAGTTCTA
TTTCCATAAAATTTATTTTATCATCTTTTCTCATAAATTTGTGCCCTCTATTTTTACTCCCAATCTGTGTAAGATGAACA
AATCTTATAAGACCACATAGCTGACTGTGATTTCAGGTGGACTCCAGGAAGGAGAACCAAAGAAAACTTTCAGTCTTTTT
AAGATGAACAAATCTTGTAAGTCCCCACATAGCTGACTGTGATTTCAGGTGGACTCCAGGAAGGAGAACCAAAGAAAAGT
TCAAGTCCAAGCAGAAACCGTGATTCCTTCCGGATGATGGCTCATGAGTGCCATTTAATTGGGGTGCCACCTGCTGTCCT
CAGCAAATCCCAGCTATATGTATATGTTCGCATTACAGGCTCATTAACCTAGGCTGACCTCTGCAAGGATCTCAGAATAT
TTTCTACAGAGAACATACATGATAATATCTGATTTTAGGACAAAAAAGTAATTCTCAATAGCAAGGGAATGGAGTAGGGT
AGACAGCTAGTAATTAAACTCACTTGTGTGTTAAAAATAAATTAAGGAAAAAAGAAAATGAGAGAACATATTACTAAATA
AAGAAAGCATACATTAAATATTTACTATAGTTTTACACTAAGAGAATAAAGGAAATGCAATAAAGTGGCCTGAAAGGTAA
AGGATGAGATGTGTAAAAGAGGCGGGGAAAGATGTGTCATTTTTTTTTTACTATGAGCAGCAATCTGAGAAGATAAAGGA
ATCGAGTTATGGGCAGACATGATGTTTGATCAGTGTTATTTGTTTTCAAGGCCTGCCTACTTTTTTTTCAAATATTACAA
ACTTTTGAAGTCACATTCTTTTTGTTTTTTGCTGTCTGTTACTAGATCGCACATTCTGTAAAGGCAGGGACCATGGTATG
TTGTTTATCTTTGGATTCTCAGTGATTGTCATATTTATGTTTGTTGAATGAATCTTAATCCAAGACTTGGGCTCCAGGTA
TCTTTCCATTCTGGTTCCAAGGAGGGACCTTCCTCACAGCAGGCGTGCTGTGTGGTCTCACATCTCACTCCTATATCTTT
CCCTGTCTGTTACTGCCCTCAGTGGAGCCCACAGTGACCATCTCCCCATCCAGGACAGAGGCCCTCAACCACCACAACCT
GCTGGTCTGCTCAGTGACAGATTTCTATCCAGCCCAGATCAAAGTCCGGTGGTTTCGGAATGACCAGGAGGAGACAACCG
GCGTTGTGTCCACCCCCCTTATTAGGAACGGTGACTGGACCTTCCAGATCCTGGTGATGCTGGAAATGACTCCCCAGCAT
GGAGACGTCTACACCTGCCACGTGGAGCACCCCAGCCTCCAGAACCCCATCACCGTGGAGTGGCGTAAGGGGATATTGAG
TTTCTGTTACTATGGGCCCCACAAGACAAAGGGCAGAGCTCATTCTGACCCATCCCTTCCCATCTCTTATCCCTGATGTC
ACTACTGAGCTGGGAATCACAGGAGACTAGAGCACTTCTTCCTCCATGGCAAGTGCATCAGAAGAATCCTGATCTCATCA
CCTTTCCAGATGCTAGGGAAATTACTCTACATACTGTTTCTCTGGATCCCAGTCCTGATAGCTCGGAGGGACTGATCATT
AGGGCTGGTGACTGGGATCTTAGGGTTTAAGGTTATGGATGAGCTCCTGAGGAGTGGAGATCTGCTTCTCCACTCTCTCA
CCTACTCACTGTACCCAAGGACCTATTGGCTGGCCTTTCCCCTCCCTTAGGGGTGGTCTGAATGGAGGACTAGTTTCCTT
TGACGCCTTCACCTCCTGAATCTCAGACTGGACTTCAGCTCCTCAGCAGGGATGCTATGGGGTGTGGGGACAAACACTGA
CACTCAGGCTCTGCTTCTTAGGGGCTCAGTCTGAATCTGCCCAGAGCAAGATGCTGAGTGGCATTGGAGGCTTCGTGCTG
GGGCTCATCTTCCTCGGGCTGGGCCTTATTATCCATCACAGGAGTCAGAAAGGTGAGGAACCCCAAGGGAAAAGGGGAAG
ATGGGCTGTGACCCAGACCCTCTGTTCAGAGAGGTCCTGTCTCTAGATGTGGCTCTTTCCTCCTGACCCCGAGAGGAAGA
AAGCTGAGCTGGAGGTGGGAGGAGACAGGACAAGATTGGAGGAGGCATTGGAATCTGATTTTACTAGTTGAAAGGTAGCC
CTGTCACACAGCTCACTGATAGAGCTTATTGAAGGACATCCTTACCTTTCATCATTGTCTCATTGGCTCCTTTCCAAAAG
CTTCCTCCATTAAGAGGGTCAGAGCCTTGGCCTCCTTGCCTTCTAGTGACAATTTCCTTTGTTTTAGGGGATTTTAAATT
AGGGTGCTTAAGGCCTTGAAGGACATGGGTGGGAAGAGAATATAACTCTAATTAAGTCACATGTGTCATTTTCCATTGGG
GTGAGAGAGTGGCTGTTTGTGTAATGAGACCTTTCTCTGCATAACTTCCTTTTGTAAGACCTCAAGGGCCTCCACCAGCA
GGTAATATTTCAGCCGTGATCCAGTGTGGGGAGGGCACAGATGTAAGAGGGAAGAGCATGAGCTGAGTGTACCTGACCAC
AGTGGTCTCCGTTCATGGTATATTTGCTGCTATGAGGATCAAGACTTAGGGGCGAAGTTTGCCAGTTTCTAGGAATCTCC
AGAGGCTGTTCCCCAGAACCAAGCCTTAACTTTGGTGGCATCTTCCTGTGAAATGTGAAGCCAGAACCACAGCTTAAATG
TTAGACACTAGGATGATGCCCACTTTGTGCCACATGTTGGTGGCTACTGCCTGTAGGCATTTTCCAGTGACTGAAAGAGG
CTGCTAGTGGTAGGGATGAGGTATCATCCAATTTCCTAAAAAGACCGAACCCTTCATATTCCCCAGAAGAGTAACAGCTG
TTCCCCCACCTCCCTCACATCTGCATCAAGCTGAAGTTCTGTGTCTTCATGAGCTGATTTCACCTTTGCACAGATCTTGG
GGGAGGTGATGACAATACACTCTGGACCTCAGCTTTGTCTGTCTGAAGCTGCAGGGGGCCCCTGAGGGGTGGGGGAGATG
GCAGGCCCACCAGCGTACCCTGTGCTGATCATCCCTCTTCTCTCTTCTCCAGGGCTCCTGCACTGACTCCTGAGACTATT
TTAACTGGGATTGGTTATCACTTTTCTGTAACGCCTGCTTGTCCCTGCCCAGAATTCCCAACTGCCTGTGTCAGCCTGTC
CCCCTGAGATCAGAGTCCTACAGTGGCTGTCACGCAGCCACCAGGTCATCTCCTTTCATCCCCACCCCAAGGCGCTGGCT
GTGACTCTGCTTCCTGCACTGACCCAGAGCC

IPD-IMGT/HLA

Sponsors