Allele Report for DQB1*03:01:01:01

DQB1*03:01:01:01 View HGVS Report
Pre-2010 Nomenclature: DQB1*030101 Local Names: DQB1*03011, DQB 3.1, DQw3.1, DQ0301W515R
IMGT/HLA Acc No: HLA00625 OMIM Entry: *604305
Assigned: 1989-08-01 Sequence Last Modified: 2005-01-12
Source Entries: AY656682 , AY663393 , AY663409 , CR933859 , L34096 , M25325 , M65040 , U83582  
Cells Sequence Derived From: 06-006 , AMALA , BM.L , CaAr , CjAr , DC , DM23 , DQB37 , JGL , JHAF , JME , JR , LUY , MG3 , NA04535 , NA14661 , NIN , SW , SWEIG007 , W515R  
Known Ethnic Origin Of Source: American Indian, Black, Caucasoid, Oriental
Publications
Horn GT et al. Proc Natl Acad Sci U S A 85:6012-6 1988. (View abstract)
Raymond CK et al. Genome Res 15:1250-7 2005. (View abstract)
Todd JA et al. Nature 329:599-604 1987. (View abstract)
Yasunaga S et al. Tissue Antigens 47:37-48 1996. (View abstract)
Michelsen B et al. J Clin Invest 79:1144-52 1987. (View abstract)
Hiraiwa A et al. Immunogenetics 29:186-90 1989. (View abstract)
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 20 Laboratories: 9
HLA Dictionary Data
Expert Assigned Type: DQ7 WHO Assigned Type: DQ7(3)
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 71 DQ7 [47-91%] DQ3 [9-44%] DQ8 [0-12%]
NMDP (2008) 12220 DQ7 [85%] DQ3 [10%] DQ8 [1%]
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: Training - DQ3 DQ7
Comments:
Protein Sequence (261 aa)
MSWKKALRIPGGLRAATVTLMLAMLSTPVAEGRDSPEDFVYQFKAMCYFTNGTERVRYVTRYIYNREEYARFDSDVEVYR
AVTPLGPPDAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIK
VRWFRNDQEETTGVVSTPLIRNGDWTFQILVMLEMTPQHGDVYTCHVEHPSLQNPITVEWRAQSESAQSKMLSGIGGFVL
GLIFLGLGLIIHHRSQKGLLH
Nucleotide Sequence Data (786 bps)
ATGTCTTGGAAAAAGGCTTTGCGGATCCCCGGAGGCCTTCGGGCAGCAACTGTTACCTTGATGCTGGCGATGCTGAGCAC
CCCAGTGGCTGAGGGCAGAGACTCTCCCGAGGATTTCGTGTACCAGTTTAAGGCCATGTGCTACTTCACCAACGGGACGG
AGCGCGTGCGTTATGTGACCAGATACATCTATAACCGAGAGGAGTACGCACGCTTCGACAGCGACGTGGAGGTGTACCGG
GCGGTGACGCCGCTGGGGCCGCCTGACGCCGAGTACTGGAACAGCCAGAAGGAAGTCCTGGAGAGGACCCGGGCGGAGTT
GGACACGGTGTGCAGACACAACTACCAGTTGGAGCTCCGCACGACCTTGCAGCGGCGAGTGGAGCCCACAGTGACCATCT
CCCCATCCAGGACAGAGGCCCTCAACCACCACAACCTGCTGGTCTGCTCAGTGACAGATTTCTATCCAGCCCAGATCAAA
GTCCGGTGGTTTCGGAATGACCAGGAGGAGACAACCGGCGTTGTGTCCACCCCCCTTATTAGGAACGGTGACTGGACCTT
CCAGATCCTGGTGATGCTGGAAATGACTCCCCAGCATGGAGACGTCTACACCTGCCACGTGGAGCACCCCAGCCTCCAGA
ACCCCATCACCGTGGAGTGGCGGGCTCAGTCTGAATCTGCCCAGAGCAAGATGCTGAGTGGCATTGGAGGCTTCGTGCTG
GGGCTCATCTTCCTCGGGCTGGGCCTTATTATCCATCACAGGAGTCAGAAAGGGCTCCTGCACTGA
Genomic Sequence Data (7231 bps)
TTCTAAGAACCTTGCTTTTTTCACCAAAACTTAAGGCTCCTCAAAGTGTGTCTAAGACAACAGCAGTAAAAATGTCTATG
ACAGCAATTTTCTCTCCCCTGAAATATGATCCCCACTTAATTTGCCCTATTGAAAGAATCCCAAGTATGAAAACAACTGG
TTTTTAATCAATATTACAAAGATGTTTACTGTTGAATCGCATTTTTTTTGGCTTCTTAAAATCCCTTAGGCATTCAGTCT
TCAGCTCTTCCATAATTGAGAGGAAATTTTCACCTCAAATGTTCATCCAGTGCAATTGGAAGACGTCACAGTGCCAGGCA
CTGGATTGAGAACCTTCACAAAAAAAAATCTGCCCAGAGACAGATGAGGTCCTTCAGCTCCAGTGCTGATTGGTTCCTTT
CCAAGGGACCATCCAATCCTACCACGCATGGAAACATCCACAGGTTTTTATTCTTTCTGCCAGGTACATCAGATCCATCA
GGTCCGAGCTGTGTTGACTACCACTACTTTTCCCTTCGTCTCAATTATGTCTTGGAAAAAGGCTTTGCGGATCCCCGGAG
GCCTTCGGGCAGCAACTGTTACCTTGATGCTGGCGATGCTGAGCACCCCAGTGGCTGAGGGCAGAGACTCTCCCGGTAAG
TGCAGGGCAGCTGCTCTCCAGAGCCGCCACTCTGGGAACAGACTCTCCTTGGGCTGGGGTATGGGGATGGTGATCTCGAT
TATCTCAGACACAATCTTTATCAATATTTCCTCTGTTTTGGGAAAGAGAGCTATGTTGCATTCCCATTTATCTTTTAATG
ATGAGGTGAGGACAATCCAATCCCATCCTACAGACTTAAGCCTGGAAGAGGAGAGAGGAGAGAAAAGAGGAGACAAAGTG
TTCATTTACTACCAGTGATAGGACAAAGTGAGCATGGGGTTATTTTTGAAGATATGAATTTCTCCAAAGACACAGCATGA
TTTGTCATTTAGGCGTGCCCCAAGACTGCCTGGACTAACTATTATGAGATCCTGCACTGGGAAATGTAAGGCAGCAATGG
TGTCTGTAGTCCCCGTATTTGGGGAAAAGGTGTCTGTATTCCTGACTCAGTGGAGCGTTTGTGGAGGCAAAATCTTGGTA
CTGAGGGAAGCTGACTGGCTGACCACAGACAGGGAGTCTTCAGGTTTCACTGATTTATGGGCAAATGGTGACCTGAGTGG
GATTCAGAGACCCGAGTTGATGGTGGACTAAATTTAGTAGAAAGGAGGATGTAAAGAAGAGAAATTACACATACTGTGAA
ACCACTCATTTCAGACACAGAACAATACTTTACATAAATTCTCTCTCACTCCTTCTAACATCCTGTGTGTAGATATCATG
ATTTTCTTTTACACAATTATACTTGTGACATGGATATTCTGTTACGTAACCTGCCCGAGCTGGTGACTGCCACAGTTTAA
TGGGATTCTAGTTTATCAAATTCAAAAGCTTGTGCTCTTTCAGTGAATAAACGTTTCTTTCTAGGACTCAGAGATCTAGG
ACTCCCTTCTTTCTAACACAGAAGTGAGTGAACCTCACAGGGCACTTGGGAGGGTAAATCCAGGCATGGGAAGGAAGGTA
TTTTACCCAGGGACCAAGAGAATAGGCATATCAAAAGAGGACAGGTTTAATTCCTGGACCTGTCTCGTCATTCCCTTGAA
CTCTCAGGTTTATGTGGATAACTTTATCTCTGAGGTACCCAGGAGCTCCATGGAAAATGGGATTTCATGCGAGAACGCCC
TGATCCCTCTAAGTGCAGAGGTCCATGCAAAATCAACCCGACTGCCTCTTCGCTTGGTTCACAGGCCCAGCCAGACAGGG
ACAGGGCTTTCCTCCCTTTCCTGCCTGTAGGAAGGCGGATTCCCGAAGACCCCCGAGAGGGCGGGCAGGGCTGGGCAGAG
CCCCCGGGAGGATCCCAGGTCTGCAGCGCGAGGCACGGGCCGGCGGGAACTGGAGGTCGCGCGGGCGGTTCCACAGCTCC
GGGCCGGGTCAGGGCGGCGGCTGCGGGGTGGCCGGGCTGGGGCCGGGCCGGGGCCGGACTGACCGGCCGGTGATTCCCCG
CAGAGGATTTCGTGTACCAGTTTAAGGCCATGTGCTACTTCACCAACGGGACGGAGCGCGTGCGTTATGTGACCAGATAC
ATCTATAACCGAGAGGAGTACGCACGCTTCGACAGCGACGTGGAGGTGTACCGGGCGGTGACGCCGCTGGGGCCGCCTGA
CGCCGAGTACTGGAACAGCCAGAAGGAAGTCCTGGAGAGGACCCGGGCGGAGTTGGACACGGTGTGCAGACACAACTACC
AGTTGGAGCTCCGCACGACCTTGCAGCGGCGAGGTGAGCGTCGTCGCCCCGCTGCGAGGCCCACTCTTGGCCGGGGCCCC
GAGTCTCTGCGCTAGGAGGGACGAGGGGGGCGAAGCCTCTGGAACCTGAGCCGCGTTCGTTCCACCCCAGGGGACAGGAG
TTGGCGGCGTGGGTGGTGGGGCAGGTGCATAGGAGGGGCAGGGACCTAGGGGCAGAGCAGGGGTACAGGTAGAGTTGGTC
AAACTGCCTAGTTTTGCCCCAGCCTTCCCGTCCGTCAGCCTCGCCCTCTGCTGTGCACGTTCTCGCCTCGTGCCTTATGC
GTTTGCCTCCTCGTGCCTTGCCTTTGCTAAGCAGTCCTCTCTGCCCCCAATTTCTGCCCTCTTCCCCTGCCCGCCCGCCC
CGCTAGCACTGCCCCACCCAGCAAGGTCCACGTGCACTGCTCGCGCCGCAGGAAGCTTCAGGCTTGGCCTGGTGGAGTTA
GGGCTGCTCCACAACTGTGCGCAGGGCATCCAGCAATTACAGTTGTGAAATAAGATATTTTGACTTTTGGCTTCAAATTA
TTATTCATCGTAATTCCGTTTTCTTAAATGGCTCTCATTCATGGCGGAGCTCTTTGAGGTGAGAGTGTTTTAATCATTTT
ATGGCCGGTACCTGACACATTGACTGGCATGTGGTATAAGCTCAATAATCTTCTGTTAAATTAATGAATAAATGTGCTCA
GCTGCCAATCCACTTAGGCTCAAGAAAAACCAGAGGTAAACAGAACCTTAAAAATGGACTTTTATTAATTATTTTCTATC
ATTTTGCTTAATTCTTTAAAGTAAACTCTTATTGACTTGGATCTAAATAGTTTGTGAATACAAAGTCTGAGGAAAAAAGT
GTTTGCTAAAAATAAAAACAACACTTGAATGATGTTTGTAAGGCAGTTTTAATTTCTTAGAAAAGCTGAACAAATGGCAC
AATGCAAAGAGCAGAAGTTTTGGAATAAATAGATTGAAGCCATTAAATTATTGGATAAAAATAGTTTCAGGTTGCTTTTG
GCCTAGGTTCTCCCCTCCCCCCATCACTATCCACTTCAGGAATAAACATTCTGAAAGTTAATTTTACCCATATAGTGAGC
ACTTATTTCTAAGTTGCCTTATCAAATACCATCTATGTTATGTCATTTAATCTCGCAGTTGCCTGTGCATTAGAGATTAG
CATCACCACTTTATATATCCTAATATTAGTACATGATAAACACTTTAAGTAATCAGCCCACAAGTACTCACCAAGACCTT
AAGCCTCCCAAAGTACACAACATTCTTACGTTCCTCACTACACATCTGTAGAGTCAAAGGGACATAAAGCCTTGTTAAAG
CCAGTTTTGACCAGAAGCAGCAATGGTCTCTTCCTGTTTGATCTCCATGTTAATGGGACAAAATGATACTTTCAAGGCAT
TGAAAATTTATGATTAATCAATCAAATTTATGATTAATCAATCCCTAGTCTGACTCCAGTGAGATTCACAAAACTTTCAG
TTTACTTTATACTCCCTTGCCTTCTTTTGACTCACATCATAGTGCCGGCAAGTACTTATATTTTTGCTATTTCAGTTCTA
TTTCCATAAAATTTATTTTATCATCTTTTCTCATAAATTTGTGCCCTCTATTTTTACTCCCAATCTGTGTAAGATGAACA
AATCTTATAAGACCACATAGCTGACTGTGATTTCAGGTGGACTCCAGGAAGGAGAACCAAAGAAAACTTTCAGTCTTTTT
AAGATGAACAAATCTTGTAAGTCCCCACATAGCTGACTGTGATTTCAGGTGGACTCCAGGAAGGAGAACCAAAGAAAAGT
TCAAGTCCAAGCAGAAACCGTGATTCCTTCCGGATGATGGCTCATGAGTGCCATTTAATTGGGGTGCCACCTGCTGTCCT
CAGCAAATCCCAGCTATATGTATATGTTCGCATTACAGGCTCATTAACCTAGGCTGACCTCTGCAAGGATCTCAGAATAT
TTTCTACAGAGAACATACATGATAATATCTGATTTTAGGACAAAAAAGTAATTCTCAATAGCAAGGGAATGGAGTAGGGT
AGACAGCTAGTAATTAAACTCACTTGTGTGTTAAAAATAAATTAAGGAAAAAAGAAAATGAGAGAACATATTACTAAATA
AAGAAAGCATACATTAAATATTTACTATAGTTTTACACTAAGAGAATAAAGGAAATGCAATAAAGTGGCCTGAAAGGTAA
AGGATGAGATGTGTAAAAGAGGCGGGGAAAGATGTGTCATTTTTTTTTTACTATGAGCAGCAATCTGAGAAGATAAAGGA
ATCGAGTTATGGGCAGACATGATGTTTGATCAGTGTTATTTGTTTTCAAGGCCTGCCTACTTTTTTTTCAAATATTACAA
ACTTTTGAAGTCACATTCTTTTTGTTTTTTGCTGTCTGTTACTAGATCGCACATTCTGTAAAGGCAGGGACCATGGTATG
TTGTTTATCTTTGGATTCTCAGTGATTGTCATATTTATGTTTGTTGAATGAATCTTAATCCAAGACTTGGGCTCCAGGTA
TCTTTCCATTCTGGTTCCAAGGAGGGACCTTCCTCACAGCAGGCGTGCTGTGTGGTCTCACATCTCACTCCTATATCTTT
CCCTGTCTGTTACTGCCCTCAGTGGAGCCCACAGTGACCATCTCCCCATCCAGGACAGAGGCCCTCAACCACCACAACCT
GCTGGTCTGCTCAGTGACAGATTTCTATCCAGCCCAGATCAAAGTCCGGTGGTTTCGGAATGACCAGGAGGAGACAACCG
GCGTTGTGTCCACCCCCCTTATTAGGAACGGTGACTGGACCTTCCAGATCCTGGTGATGCTGGAAATGACTCCCCAGCAT
GGAGACGTCTACACCTGCCACGTGGAGCACCCCAGCCTCCAGAACCCCATCACCGTGGAGTGGCGTAAGGGGATATTGAG
TTTCTGTTACTATGGGCCCCACAAGACAAAGGGCAGAGCTCATTCTGACCCATCCCTTCCCATCTCTTATCCCTGATGTC
ACTACTGAGCTGGGAATCACAGGAGACTAGAGCACTTCTTCCTCCATGGCAAGTGCATCAGAAGAATCCTGATCTCATCA
CCTTTCCAGATGCTAGGGAAATTACTCTACATACTGTTTCTCTGGATCCCAGTCCTGATAGCTCGGAGGGACTGATCATT
AGGGCTGGTGACTGGGATCTTAGGGTTTAAGGTTATGGATGAGCTCCTGAGGAGTGGAGATCTGCTTCTCCACTCTCTCA
CCTACTCACTGTACCCAAGGACCTATTGGCTGGCCTTTCCCCTCCCTTAGGGGTGGTCTGAATGGAGGACTAGTTTCCTT
TGACGCCTTCACCTCCTGAATCTCAGACTGGACTTCAGCTCCTCAGCAGGGATGCTATGGGGTGTGGGGACAAACACTGA
CACTCAGGCTCTGCTTCTTAGGGGCTCAGTCTGAATCTGCCCAGAGCAAGATGCTGAGTGGCATTGGAGGCTTCGTGCTG
GGGCTCATCTTCCTCGGGCTGGGCCTTATTATCCATCACAGGAGTCAGAAAGGTGAGGAACCCCAAGGGAAAAGGGGAAG
ATGGGCTGTGACCCAGACCCTCTGTTCAGAGAGGTCCTGTCTCTAGATGTGGCTCTTTCCTCCTGACCCCGAGAGGAAGA
AAGCTGAGCTGGAGGTGGGAGGAGACAGGACAAGATTGGAGGAGGCATTGGAATCTGATTTTACTAGTTGAAAGGTAGCC
CTGTCACACAGCTCACTGATAGAGCTTATTGAAGGACATCCTTACCTTTCATCATTGTCTCATTGGCTCCTTTCCAAAAG
CTTCCTCCATTAAGAGGGTCAGAGCCTTGGCCTCCTTGCCTTCTAGTGACAATTTCCTTTGTTTTAGGGGATTTTAAATT
AGGGTGCTTAAGGCCTTGAAGGACATGGGTGGGAAGAGAATATAACTCTAATTAAGTCACATGTGTCATTTTCCATTGGG
GTGAGAGAGTGGCTGTTTGTGTAATGAGACCTTTCTCTGCATAACTTCCTTTTGTAAGACCTCAAGGGCCTCCACCAGCA
GGTAATATTTCAGCCGTGATCCAGTGTGGGGAGGGCACAGATGTAAGAGGGAAGAGCATGAGCTGAGTGTACCTGACCAC
AGTGGTCTCCGTTCATGGTATATTTGCTGCTATGAGGATCAAGACTTAGGGGCGAAGTTTGCCAGTTTCTAGGAATCTCC
AGAGGCTGTTCCCCAGAACCAAGCCTTAACTTTGGTGGCATCTTCCTGTGAAATGTGAAGCCAGAACCACAGCTTAAATG
TTAGACACTAGGATGATGCCCACTTTGTGCCACATGTTGGTGGCTACTGCCTGTAGGCATTTTCCAGTGACTGAAAGAGG
CTGCTAGTGGTAGGGATGAGGTATCATCCAATTTCCTAAAAAGACCGAACCCTTCATATTCCCCAGAAGAGTAACAGCTG
TTCCCCCACCTCCCTCACATCTGCATCAAGCTGAAGTTCTGTGTCTTCATGAGCTGATTTCACCTTTGCACAGATCTTGG
GGGAGGTGATGACAATACACTCTGGACCTCAGCTTTGTCTGTCTGAAGCTGCAGGGGGCCCCTGAGGGGTGGGGGAGATG
GCAGGCCCACCAGCGTACCCTGTGCTGATCATCCCTCTTCTCTCTTCTCCAGGGCTCCTGCACTGACTCCTGAGACTATT
TTAACTGGGATTGGTTATCACTTTTCTGTAACGCCTGCTTGTCCCTGCCCAGAATTCCCAACTGCCTGTGTCAGCCTGTC
CCCCTGAGATCAGAGTCCTACAGTGGCTGTCACGCAGCCACCAGGTCATCTCCTTTCATCCCCACCCCAAGGCGCTGGCT
GTGACTCTGCTTCCTGCACTGACCCAGAGCC

IMGT/HLA

Sponsors

Animated Sponsors Logo