Allele Report for DQB1*03:26

DQB1*03:26 View HGVS Report
Pre-2010 Nomenclature: DQB1*0326 Local Names: 2009-CAP-DL03
IMGT/HLA Acc No: HLA04356 OMIM Entry: *604305
Assigned: 2009-09-30 Sequence Last Modified: 2009-10-19
Source Entries: FN550110  
Cells Sequence Derived From: 2009-CAP-DL03  
Known Ethnic Origin Of Source: Unknown
Publications
Chen MJ et al. Int J Immunogenet 37:455-457 2010. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
DFVYQFKGLCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRAVTPLGPPDAEYWNSQKEVLERTRAELDTVCRHNYQL
ELRTTLQRR
Nucleotide Sequence Data (270 bps)
AGGATTTCGTGTACCAGTTTAAGGGCCTGTGCTACTTCACCAACGGGACGGAGCGCGTGCGTCTTGTGACCAGATACATC
TATAACCGAGAGGAGTACGCACGCTTCGACAGCGACGTGGGGGTGTATCGGGCGGTGACGCCGCTGGGGCCGCCTGACGC
CGAGTACTGGAACAGCCAGAAGGAAGTCCTGGAGAGGACCCGGGCGGAGTTGGACACGGTGTGCAGACACAACTACCAGT
TGGAGCTCCGCACGACCTTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo