Allele Report for DQB1*03:22

DQB1*03:22 View HGVS Report
Pre-2010 Nomenclature: DQB1*0322 Local Names: HLA-DQB1*03new
IMGT/HLA Acc No: HLA03295 OMIM Entry: *604305
Assigned: 2008-04-29 Sequence Last Modified: 2008-10-10
Source Entries: AM944346  
Cells Sequence Derived From: 175842  
Known Ethnic Origin Of Source: Unknown
Publications
Witter K et al. Tissue Antigens 73:283-5 2009. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (183 aa)
DFVYQFKAMCYFTNGTERVRYVTRYIYNREEYARFDSDVEVYRAVTPLGPPDAEYWNSQKEVLERTRAELDTVCRHNYQL
ELRTTLQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVQWFRNDQEETTGVVSTPLIRNGDWTFQILVMLEMTP
QHGDVYTCHVEHPSLQNPITVEW
Nucleotide Sequence Data (552 bps)
AGGATTTCGTGTACCAGTTTAAGGCCATGTGCTACTTCACCAACGGGACGGAGCGCGTGCGTTATGTGACCAGATACATC
TATAACCGAGAGGAGTACGCACGCTTCGACAGCGACGTGGAGGTGTACCGGGCGGTGACGCCGCTGGGGCCGCCTGACGC
CGAGTACTGGAACAGCCAGAAGGAAGTCCTGGAGAGGACCCGGGCGGAGTTGGACACGGTGTGCAGACACAACTACCAGT
TGGAGCTCCGCACGACCTTGCAGCGGCGAGTGGAGCCCACAGTGACCATCTCCCCATCCAGGACAGAGGCCCTCAACCAC
CACAACCTGCTGGTCTGCTCAGTGACAGATTTCTATCCAGCCCAGATCAAAGTCCAGTGGTTTCGGAATGACCAGGAGGA
GACAACCGGCGTTGTGTCCACCCCCCTTATTAGGAACGGTGACTGGACCTTCCAGATCCTGGTGATGCTGGAAATGACTC
CCCAGCATGGAGACGTCTACACCTGCCACGTGGAGCACCCCAGCCTCCAGAACCCCATCACCGTGGAGTGGC
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo