Allele Report for DQB1*03:17:01

DQB1*03:17:01 View HGVS Report
Pre-2010 Nomenclature: DQB1*0317 Local Names: DQ03v
IMGT/HLA Acc No: HLA02323 OMIM Entry: *604305
Assigned: 2005-08-25 Sequence Last Modified: 2005-10-07
Source Entries: DQ114427  
Cells Sequence Derived From: K32633 , K32633F  
Known Ethnic Origin Of Source: Oriental
Publications
Chu CC et al. Tissue Antigens 69:370-2 2007. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 1
HLA Dictionary Data
Expert Assigned Type: DQ9 WHO Assigned Type: -
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) - -
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DQ9
Comments:
Protein Sequence (89 aa)
DFVYQFKGMCYFTNGTERVRGVTRYIYNREEYARFDSDVGVYRAVTPLGPPDAEYWNSQKEVLERTRAELDTVCRHNYQL
ELRTTLQRR
Nucleotide Sequence Data (270 bps)
AGGATTTCGTGTACCAGTTTAAGGGCATGTGCTACTTCACCAACGGGACCGAGCGCGTGCGGGGTGTGACCAGATACATC
TATAACCGAGAGGAGTACGCACGCTTCGACAGCGACGTGGGGGTGTATCGGGCGGTGACGCCGCTGGGGCCGCCTGACGC
CGAGTACTGGAACAGCCAGAAGGAAGTCCTGGAGAGGACCCGGGCGGAGTTGGACACGGTGTGCAGACACAACTACCAGT
TGGAGCTCCGCACGACCTTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo