Allele Report for DQB1*03:13

DQB1*03:13 View HGVS Report
Pre-2010 Nomenclature: DQB1*0313 Local Names: DQB1
IMGT/HLA Acc No: HLA01589 OMIM Entry: *604305
Assigned: 2002-03-28 Sequence Last Modified: 2002-04-08
Source Entries: AF479569 , HE995409  
Alignment of CDS Source Entries
DQB1*05:01:01:01
DQB1*03:13
Submission 1
Submission 2

Locus Reference
  Virtual entry for DQB1*03:13 
  Individual submission(s) 
Cells Sequence Derived From: 10993426 , D261617  
Known Ethnic Origin Of Source: Oriental
CWD v2.0 Status: Well-Documented
ISO OID: 2.16.840.1.113883.13.252 (HL7 Registered Organisational OID)
2.16.840.1.113883.13.252.1.1.1589 (Allele OID)
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
HLA Dictionary Data
Expert Assigned Type: DQ7 WHO Assigned Type: -
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) - -
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DQ7
Comments:
Protein Sequence (89 aa)
DFVYQFKAMCYFTNGTERVRYVTRYIYNREEYARFDSDVEVYRAVTPLGPPDAEYWNSQKEDLERTRAELDTVCRHNYQL
ELRTTLQRR
Nucleotide Sequence Data (270 bps)
AGGATTTCGTGTACCAGTTTAAGGCCATGTGCTACTTCACCAACGGGACGGAGCGCGTGCGTTATGTGACCAGATACATC
TATAACCGAGAGGAGTACGCACGCTTCGACAGCGACGTGGAGGTGTACCGGGCGGTGACGCCGCTGGGGCCGCCTGACGC
CGAGTACTGGAACAGCCAGAAGGAAGACCTGGAGAGGACCCGGGCGGAGTTGGACACGGTGTGCAGACACAACTACCAGT
TGGAGCTCCGCACGACCTTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IPD-IMGT/HLA

Sponsors