Allele Report for DQB1*03:05:04

DQB1*03:05:04 View HGVS Report
Pre-2010 Nomenclature: DQB1*030504 Local Names: DQB1*0305GR
IMGT/HLA Acc No: HLA02497 OMIM Entry: *604305
Assigned: 2006-03-22 Sequence Last Modified: 2006-04-07
Source Entries: AM231062  
Cells Sequence Derived From: IA  
Known Ethnic Origin Of Source: Caucasoid
Publications
Visschedijk MC et al. Tissue Antigens 68:189-90 2006. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Expert Assigned Type: DQ8 WHO Assigned Type: DQ8(3)
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) 70 DQ8 [34%] DQ3 [30%]
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DQ8
Comments:
Protein Sequence (89 aa)
DFVYQFKGMCYFTNGTERVRGVTRYIYNREEYARFDSDVGVYRAVTPLGPPAAEYWNSQKEVLERTRAELDTVCRHNYQL
ELRTTLQRR
Nucleotide Sequence Data (270 bps)
AGGATTTCGTGTACCAGTTTAAGGGCATGTGCTACTTCACCAACGGGACGGAGCGCGTGCGGGGTGTGACCAGATACATC
TATAACCGAGAGGAGTACGCACGCTTCGACAGCGACGTGGGGGTGTATCGGGCGGTGACGCCGCTGGGGCCGCCTGCCGC
CGAGTACTGGAACAGCCAGAAGGAAGTCCTGGAGAGGACCCGGGCGGAGTTGGACACGGTGTGCAGACACAACTACCAGT
TGGAGCTCCGCACGACCTTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo